SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004764567.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004764567.1.14098
Domain Number 1 Region: 118-296
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-36
Family BCR-homology GTPase activation domain (BH-domain) 0.000000178
Further Details:      
 
Domain Number 2 Region: 616-722
Classification Level Classification E-value
Superfamily SH2 domain 7.27e-31
Family SH2 domain 0.000000653
Further Details:      
 
Domain Number 3 Region: 324-431
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-30
Family SH2 domain 0.000000627
Further Details:      
 
Domain Number 4 Region: 4-83
Classification Level Classification E-value
Superfamily SH3-domain 6.96e-17
Family SH3-domain 0.00000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004764567.1.14098
Sequence length 725
Comment PREDICTED: phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MSAEGYQYRALYDYKKERDEDIDLHLGDVLTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKAEADSEQQQALALPDLA
EQFAPPDIAPPLLVKLLEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASMDLEMIDV
QVLGDAFKRYLMDLPNPVIPVAVYNEMIYLAQEVQSSEDYIQLLKKLIRAPNIPHQYWLT
LQYLLKHFFKLCQTSSKNLLSARVLSELFSPLLFRFPAASSENTEHLIKVIEILISTEWN
ERQPAPALPPKPPKPTSVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRD
ASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPK
LDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQM
KRTAIEAFNETIKIFEEQCQSQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIV
DSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLG
NENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYAC
SVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVY
AQQRR
Download sequence
Identical sequences M3YTF0
ENSMPUP00000014610 ENSMPUP00000014610 XP_004764567.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]