SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004764901.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004764901.1.14098
Domain Number 1 Region: 958-1160
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000763
Family WD40-repeat 0.025
Further Details:      
 
Weak hits

Sequence:  XP_004764901.1.14098
Domain Number - Region: 490-543
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00235
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004764901.1.14098
Sequence length 1320
Comment PREDICTED: C-Jun-amino-terminal kinase-interacting protein 4 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MELEDGVVYQEEPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLEN
LDSVFAQEQEHQVELELLRDDNEQLITQYQREKALRKHAEEKFIEFEDSQEQEKKDLQTR
VESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLH
QLSGSEQLESTAHSRIRKERPISLGIFPLPAGDGLLTPDTQKGGETPGSEQWKFQELSQP
RSHTSLKDELSDVSQGGSKATTPASTAASDVATLPTDTPLKEDNEGFVKVADTPNKSEIS
KHIEVQVAQETRNVSTGSAENEEKSEVQAIIESTPELDMDKDLSGYKGSSTPTKGIENKA
FDRNTESLFEELSSAGSGLIGDVDEGADLLGMGREVENLILENTQLLETKHALNVVKNDL
IAKVDELTCEKDVLQGELEAVKLAKLKLEEKNKELEEELRKARAEAEDARQKAKDDDDSD
IPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAMQEKKRSSIWQ
FFSRLFSSSSNTTKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSKAFDFLSEET
EASLASRREQKREQYRQVKAHVQKEDGRVQAFGWSLPQKYKQVTNGQGENKMKNLPVPVY
LRPLDEKDTSMKLWCAVGVNLSGGKTRDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSL
DKLDQELKEQQKELKNQEELSSLVWICTSTHSATKVIIIDAVQPGNILDSFTVCNSHVLC
IASVPGARETDYPAGEELSESGQVDKASLCGSMTSNSSAETDSLLGGITVVGCSAEGVTA
AATSPSTNGASPVMEKPPEKEAENSEVDENVPTAEEATEATEGNAGSTEDTVDISQPGVY
TEHVFTDPLGVQIPEDLSPVYQSSNDSDAYKDQLSVLPNEQDLVREEAQKMSSLLPTMWL
GAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVDGQWD
LSNYHLLDLGRPHHSVRCMAVVHDKVWCGYRNKVYVVQPKAMKIEKSFDAHPRKESQVRQ
LAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVS
CNRLWVGTGNGVIISIPLTETVILHQGRLLGLRANKTSGAPGNRPGSVIRVYGDENSDKV
TPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVVSPQTGSSGTDLTGDKAGPSTQEPG
SQAPLKSMLVISGGEGYIDFRMGDEGGESELLGEDLPLEPSVAKAERSHLIVWQVMYGSE
Download sequence
Identical sequences M3YVT4
ENSMPUP00000015444 XP_004764901.1.14098 ENSMPUP00000015444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]