SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004765562.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004765562.1.14098
Domain Number 1 Region: 17-339
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.76e-119
Family Aldose 1-epimerase (mutarotase) 0.0000000000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004765562.1.14098
Sequence length 342
Comment PREDICTED: aldose 1-epimerase [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MASVTRAVFGDLPSGAGTVEKFQLQSDLLKVDIISWGCTITALEVKDRQGRASDVVLGFA
ELEGYLQKQPYFGAVVGRVANRIAKGTFTLDGKEYKLPVNNGPNSLHGGVRGFDKVLWTP
QVLSNGVQFSRVSPDGEEGYPGELKVWVTYTLDGGELMINYRAQASRTTPVNLTNHSYFN
LAGQGSPNIYDHEITIEADAFLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQEFRIN
GFDHNFCLKGSKEKHFCARVRHAGSGRVLEVYTTQPGVQFYTGNFLDGTLQGKRGAVYPK
HSGFCLETQNWPDAVNQPHFPPVLLRPGEEYDHTTWFKFTVA
Download sequence
Identical sequences M3YG87
ENSMPUP00000010344 ENSMPUP00000010344 XP_004765562.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]