SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004767563.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004767563.1.14098
Domain Number 1 Region: 307-393
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000128
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00094
Further Details:      
 
Domain Number 2 Region: 146-198
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000102
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 3 Region: 45-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000641
Family HLH, helix-loop-helix DNA-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004767563.1.14098
Sequence length 593
Comment PREDICTED: neuronal PAS domain-containing protein 1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAAPYPSSGSGGEVKCGGGRGRSVPWDFLPGLVVKAPPGPCLQAQRKEKSRNAARSRRGK
ENLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRAAGPPAGLA
PGHRGRVALVSEVFEQHLGGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGS
SVFDYIHPGDHSEVLEQLGLRAPTPGPPTPPSVPSSSSSSSSSSLADTPEIEASATEVPP
FSRVQERSFFIRMKSTLTKRGLHVKASGYKVIHVTGRLRARSLGLVALGHTLPPAPLAEL
PLHGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDAARIRQSHLDLL
DKGQVMTGYYRWLQRAGGFVWLQSVATVAVSGKSPGERHVLWVSYVLSQAEGGQTPLDAF
QLPASVACEDTSSPEPEPTEPEPPGEGKQAAPLDKDEAPRSRGKRIKVEPGPGQAKDPED
SGDEESSGHLALPRPEFTSVIRAGALKQDLVRPWGLGPPGDPSPSLLHAGFLPPVVRGLC
TPGTIRYGPAELGLVYPHLQRLAPGPTLPEAFYPTLGLSYPGTTGTRVQRKGD
Download sequence
Identical sequences M3Y181
XP_004767562.1.14098 XP_004767563.1.14098 XP_012919547.1.14098 ENSMPUP00000005082 ENSMPUP00000005082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]