SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004771492.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004771492.1.14098
Domain Number 1 Region: 216-335
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-28
Family SH2 domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004771492.1.14098
Sequence length 340
Comment PREDICTED: SH2 domain-containing adapter protein D isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MARWLRDYLGFGGRRPPPQPPAPDYTESDILRAYREQKNLDFEDPYEDSDSRLDPDPAGP
GDPKGLGDAKYDSPKHRLIKVEAADMARAKVLLGSPGEELELDTEYSDPFDAQPPPPPSE
DGYMEPYDAQRAVSELPCKGVQLYDTPYEEQDQEPGDGALSGRRPRQSRLPQEDERPADE
YDQPWEWKKDHISKAFAVQFDSPEWERTAGSAKDLRRPPSRSPQPAERVDPALPLEKQPW
FHGPLSRADAENLLSLCKAGSYLVRLSETSPQDCSLSLRSSQSFLHLKFARTRENQFVLG
QHSGPFASVPELVLHYSSRPLPVQGAEHLALLYPVVTQNP
Download sequence
Identical sequences M3Y0M3
ENSMPUP00000004874 XP_004771492.1.14098 ENSMPUP00000004874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]