SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004838657.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004838657.1.39548
Domain Number 1 Region: 125-293
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.15e-50
Family Ankyrin repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004838657.1.39548
Sequence length 332
Comment PREDICTED: ankyrin repeat domain-containing protein 2 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MEGTVEGSEAVQRATALIEQRLAEEEENEKLQGTSHRKLPMEMLVLEDEKHLGAQSQALQ
KVKSQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQRKREALAAAQEPPPELEEISGPV
DKEMFLKAAVEGKMKVIEKFLADGGSADTCDEFHRTALHRASLEGHMEILEKLLGNGATV
DFQDRLDCTAMHWACRGGHLEVVKLLQSRGADTNVRDKLLSTPLHVAVRTGHVEIVEHFL
SLGVDINVRDREGDSALHDAVRLNRYKIIKLLLLHGADMMAKNLAGKTPTDLVQLWQADT
RHALEHPEPATEQNGLEGSESGRETPQQVPAQ
Download sequence
Identical sequences G5C0C0
HGL_H00000306163 XP_004838657.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]