SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004839953.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004839953.1.39548
Domain Number 1 Region: 3-102
Classification Level Classification E-value
Superfamily Histone-fold 6.08e-43
Family Nucleosome core histones 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004839953.1.39548
Sequence length 128
Comment PREDICTED: histone H2A.V isoform X1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTA
Download sequence
Identical sequences A0A087XPC7 A0A098LZK7 A0A0B8RYM2 A0A0D9RT40 A0A0P6JUM7 A0A0P7UYK1 A0A151NP39 A0A1A8DBP9 A0A1A8EYS6 A0A1A8K504 A0A1A8MFS9 A0A1A8Q5G0 A0A1D8QQG2 A0A1S3WD96 A0A1U7RGH9 A0A1U7TYH7 A0A1V4KR18 A0A1W7RGS9 A0A250XV01 A0A286XNT3 A0A287D335 A0A2H6MVL8 A0A2I3MDP8 A0A2I4AHI3 A0A2K5CFP6 A0A2K5KI01 A0A2K5QLX0 A0A2K5TQR4 A0A2K5Z5X1 A0A2K6CFZ8 A0A2K6FH47 A0A2K6KG57 A0A2K6Q960 A2BFY9 B2RVP5 B5DGB8 B5G0I6 C1BFL4 C1BLK3 C1BX55 C3KHK5 D4AEC0 E3TFA0 F2Z5P1 F7G9F5 G1QVD1 G3HMB9 G3PNW6 G3WXN6 H2PM72 H2QUI9 H2UVK6 H3AVH7 H3DDW0 H9EMQ0 H9GAV4 I3K874 J3RZQ4 J9P3D2 K4NCJ2 K7FEE9 M4AQU9 P02272 Q32LA7 Q3THW5 Q5BJ65 Q6GM74 Q6Y237 Q71PD7 Q71UI9 T1DKX1 U3EEU6 U3ESV9 U6DXB2 W5KK99 W5ZME2
ENSMODP00000020077 gi|147903565|ref|NP_001087351| gi|148235614|ref|NP_001086112| gi|49256106|gb|AAH74203| gi|51593518|gb|AAH78599| gi|82201002|sp|Q6GM74| ENSPFOP00000007630 ENSGMOP00000005655 ENSGACP00000019299 ENSXETP00000002709 ENSONIP00000017319 ENSRNOP00000045180 ENSACAP00000005903 ENSXETP00000002709 NP_001016178.1.99540 NP_001033286.1.59421 NP_001033286.1.76553 NP_001086112.1.7800 NP_001087351.1.7800 NP_001099489.1.100692 NP_001099489.1.4139 NP_001184228.1.42559 NP_001297885.1.71217 NP_036544.1.87134 NP_036544.1.92137 NP_084214.1.92730 NP_705930.1.45394 XP_003227465.1.98722 XP_003268919.1.23891 XP_003465852.1.53824 XP_003504811.1.69978 XP_003757790.1.9362 XP_003797644.2.62490 XP_003805268.1.60992 XP_003975126.1.43653 XP_004283037.1.21590 XP_004386157.1.4749 XP_004414116.1.74151 XP_004438396.1.5094 XP_004457527.1.11602 XP_004555835.1.88231 XP_004582293.1.84141 XP_004630416.1.9945 XP_004652975.1.11716 XP_004839953.1.39548 XP_005086833.1.91757 XP_005319307.1.77405 XP_005366260.1.66349 XP_005549717.1.63531 XP_005730683.1.53837 XP_005812570.1.87360 XP_005950650.1.24487 XP_005995244.1.90931 XP_006106769.1.53796 XP_006217196.1.17985 XP_006275074.1.47583 XP_006797729.1.46954 XP_006832164.1.41390 XP_006973069.1.50099 XP_007118958.1.24612 XP_007238208.1.101067 XP_007430054.1.37977 XP_007447081.1.90284 XP_007475948.1.35504 XP_007575759.1.10163 XP_007956075.1.48129 XP_007979606.1.81039 XP_008065059.1.4292 XP_008172145.1.60341 XP_008286891.1.38333 XP_008333357.1.100486 XP_008334511.1.100486 XP_008334512.1.100486 XP_008417540.1.1237 XP_008832315.1.79516 XP_009000387.1.60252 XP_009451295.1.37143 XP_010372882.1.97406 XP_010561199.1.12557 XP_010596578.1.64505 XP_010734849.1.61708 XP_010787000.1.77114 XP_010827338.1.44457 XP_010986189.1.51371 XP_011383065.1.92234 XP_011491502.1.28442 XP_011760814.1.29376 XP_011838658.1.47321 XP_011939860.1.92194 XP_012352213.1.23891 XP_012422693.1.74151 XP_012502363.1.63892 XP_012590482.1.23501 XP_012670709.1.3086 XP_012675802.1.3086 XP_012735266.1.37407 XP_013809387.1.3284 XP_013854970.1.33752 XP_013967513.1.84170 XP_013983482.1.97760 XP_013995973.1.97760 XP_013998830.1.97760 XP_014434750.1.96668 XP_014434751.1.96668 XP_014683858.1.49734 XP_014829591.1.96476 XP_014902603.1.100837 XP_014989034.1.72884 XP_015128745.1.86415 XP_015195830.1.81211 XP_015257483.1.42780 XP_015263651.1.55130 XP_015671994.1.16292 XP_016003367.1.101085 XP_016044262.1.11023 XP_016316206.1.79318 XP_016428272.1.44103 XP_016800796.1.37143 XP_017283364.1.84151 XP_017307818.1.5077 XP_017343798.1.5077 XP_017380086.1.71028 XP_017560587.1.86671 XP_017727148.1.44346 XP_018411293.1.44173 XP_018524578.1.34915 XP_018605781.1.37976 XP_018617994.1.37976 XP_018928484.1.5815 XP_018928485.1.5815 XP_019221421.1.78416 XP_019306471.1.44245 XP_019401571.1.79039 XP_019482138.1.44202 XP_019794683.1.83887 XP_019814479.1.53367 XP_019965900.1.63745 XP_020019562.1.5219 XP_020145515.1.48125 XP_020313608.1.87700 XP_020321591.1.87700 XP_020331438.1.87700 XP_020346086.1.87700 XP_020377988.1.65276 XP_020492264.1.8198 XP_020748947.1.74333 XP_020839689.1.61212 XP_020934317.1.46622 XP_021066214.1.100879 XP_021230676.1.32913 XP_021400500.1.53032 XP_021446169.1.32639 XP_021457626.1.32639 XP_021462303.1.32639 XP_021477838.1.32639 XP_021488404.1.76796 XP_021525010.1.9421 XP_021559315.1.83697 XP_022063388.1.10920 ENSBTAP00000022576 ENSSHAP00000020191 ENSDARP00000090434 ENSNLEP00000004902 ENSMUSP00000105359 ENSONIP00000017319 10116.ENSRNOP00000045180 31033.ENSTRUP00000040984 69293.ENSGACP00000019299 7955.ENSDARP00000068975 7955.ENSDARP00000090434 9600.ENSPPYP00000019708 9606.ENSP00000308405 9913.ENSBTAP00000022576 99883.ENSTNIP00000018703 ENSPVAP00000001047 ENSAMXP00000008011 ENSTRUP00000040984 ENSXMAP00000016844 ENSTNIP00000018703 ENSGACP00000019299 ENSPPYP00000019708 ENSP00000340708 ENSCAFP00000040061 ENSPSIP00000006409 ENSDARP00000090434 ENSPANP00000004892 ENSTNIP00000018703 ENSPVAP00000001047 ENSSHAP00000020191 ENSPTRP00000032725 gi|6912616|ref|NP_036544.1| ENSRNOP00000009205 gi|60552501|gb|AAH91605| gi|62859155|ref|NP_001016178| gi|82194134|sp|Q5BJ65| gi|89268257|gb|CAJ81609| ENSPPYP00000024553 ENSP00000308405 ENSBTAP00000022576 ENSXMAP00000016844 ENSPSIP00000006409 ENSP00000308405 ENSTRUP00000040984 ENSLACP00000013648 ENSMODP00000020077 ENSPTRP00000032725 ENSCAFP00000040061 ENSGMOP00000005655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]