SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004843539.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004843539.1.39548
Domain Number 1 Region: 13-70,98-158
Classification Level Classification E-value
Superfamily POZ domain 1.29e-27
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 354-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000106
Family Classic zinc finger, C2H2 0.00082
Further Details:      
 
Domain Number 3 Region: 392-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000238
Family Classic zinc finger, C2H2 0.00068
Further Details:      
 
Domain Number 4 Region: 465-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000393
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 5 Region: 594-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000662
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Weak hits

Sequence:  XP_004843539.1.39548
Domain Number - Region: 291-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00196
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004843539.1.39548
Sequence length 687
Comment PREDICTED: POZ-, AT hook-, and zinc finger-containing protein 1 isoform X1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDESFPAHRAVLA
ACSEYFESVFSAQLGDGGAADGGPSDVGGASAAPGGGAGGSRELEMHTISSKVFGDILDF
AYTSRIVVRLESFPELMTAAKFLLMRSVIEICQEVIKQSNVQILVPPARADIMLFRPPGT
SDLGFPLDMTNGAALAANSNGIAGSMQPEEEAARAAGAAISSQASLPVLPGVDRLPMVAG
PLSPQLLTSPFPNVASSTPPLTGKRGRGRPRKANLLDSMLGSPGGLREAGILPCGLCGKV
FTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEIC
GKIFRDVYHLNRHKLSHSGEKPYSCPVCGLRFKRKDRMSYHVRSHDGSVGKPYICQSCGK
GFSRPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLRSHLACHEDKVPCQVCGKYLRAA
YMADHLKKHSEGPSNFCSICNRGFSSASYLKVHVKTHHGVPLPQVSRHQEPIPNGGAAFH
CARTYGNKEGQKCSHQDPIESSDSYGDLSDASDLKTPEKQSTNGSFSCDMAVPKNKMESD
GEKKYPCPECGSFFRSKSYLNKHIQKVHVRSLGGSLGDLGPALGSPFSPQQNMSLLESFG
FQIVQSAFASSLVDPEVDQQPMGPEGK
Download sequence
Identical sequences G5BBU9
XP_004843539.1.39548 HGL_H00000266269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]