SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004850212.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004850212.1.39548
Domain Number 1 Region: 181-419
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.63e-51
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 18-130
Classification Level Classification E-value
Superfamily POZ domain 9.68e-30
Family Tetramerization domain of potassium channels 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004850212.1.39548
Sequence length 478
Comment PREDICTED: potassium voltage-gated channel subfamily S member 2 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MTRQSLWDVSEANVVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAMLELC
DDYDDAQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCC
SYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDN
PGYSVLSRVFSVLSILVVLGSIITMCLNSLPDFQIPDSQGNPGEDPRFEIVEHFGIAWFT
LELVARFAVAPDFFQFFKNALNLIDLMSIVPFYITLVVNLVVESTPTLANLGRVAQVLRL
MRIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTIEKEENEGLA
TIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRR
QKQLESAMRSCDFGDGMKEVPSINLRDYYAHKVKSLMASLTNMSRSSPSELSLNDSLH
Download sequence
Identical sequences G5B8Y7
XP_004850212.1.39548 HGL_H00000287042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]