SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004851559.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004851559.1.39548
Domain Number 1 Region: 156-352
Classification Level Classification E-value
Superfamily E set domains 5.6e-72
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000247
Further Details:      
 
Domain Number 2 Region: 48-171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-22
Family Voltage-gated potassium channels 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004851559.1.39548
Sequence length 390
Comment PREDICTED: ATP-sensitive inward rectifier potassium channel 11 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MLSRKGIIPEEYVLTRLAEDPAEPRYHARERKARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMIWWLIAFAHGDLAPGEGTTVPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLGPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGHRFVPIVTEEDGRYSVDYSKFGNTIKVPTPLCTAHQLDEDHSLLDALT
LASTRGPLRKRSVPVAKTKPKFSISPDSLS
Download sequence
Identical sequences G5BNQ4
HGL_H00000345708 XP_004851559.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]