SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004852686.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004852686.1.39548
Domain Number 1 Region: 638-893
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-55
Family YWTD domain 0.00000646
Further Details:      
 
Domain Number 2 Region: 26-286
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-54
Family YWTD domain 0.00000163
Further Details:      
 
Domain Number 3 Region: 337-567
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-51
Family YWTD domain 0.00000241
Further Details:      
 
Domain Number 4 Region: 940-1195
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-38
Family YWTD domain 0.0000725
Further Details:      
 
Domain Number 5 Region: 1326-1362
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000681
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1288-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1248-1286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 593-639
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000207
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 9 Region: 896-947
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000285
Family EGF-type module 0.025
Further Details:      
 
Domain Number 10 Region: 291-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000649
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1205-1257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000931
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004852686.1.39548
Sequence length 1606
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MGAAPPRPPLVLLALCCSLAPAAASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAA
VDFQFSKGAVYWTDVSEEAIKQTYLNQTGAATQNVIVSGLVSPDGLACDWVGKKLYWTDS
ETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRK
IIVDSEIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSG
DTLYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDIQVLSQERQPFFHTQCEEDNGGCS
HLCLLSPREPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVL
QVEDIRHAIAIDYDPLEGHVYWTDDEVRAIRRARLDGSGAQTLVNTEINDPDGIAVDWVA
RNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKIECA
NLDGRERHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPH
IFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVIGTNPCAD
GNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDV
AIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDW
MGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIV
RAFMDGTNCITLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPH
PFGLTQYSNYIYWTDWNLHSIERADKTSGRNRTLVQGHLDFVMDILVFHSSRQDGLNDCV
HNNGQCEQLCLAIPGGHRCGCASHYTLDPSSRNCSPPSTFLLFSQKCAISRMIPDDQHSP
DLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGSQTFVLTSPGQSPDRQPHDL
SIDIYSRTLFWTCEAANTINVHRLDGDAMGVVLRGDRDKPRAITVNAERGYLYFTNMQDR
AAKIERAALDGTEREVLFTTGLIRPVALVVDNALGKLFWVDADLKRIESCDLSGANRLTL
EDANIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRIQGRVAHLTGIHAVEEVNL
EEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATG
EIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDE
ADCDAVCLPNQFRCASGQCVLIKQQCDSFPDCVDGSDELMCEITKPPSDETPAHSSAIGP
VIGIILTLFIMGGLYFVCQRVVCQRYSGASGPFPHEYVSGTPHVPLNFIAPGGSQHGPFP
GISCSKSVMSSVSLMGGRSGAPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPS
LYNMDMFYSSNIPATTRAYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSD
SDPYPPPPTPHSQYLSAEDSCPPSPVTERSYCHLFPPPPSPCTDSS
Download sequence
Identical sequences XP_004852686.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]