SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004853020.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004853020.1.39548
Domain Number 1 Region: 156-251
Classification Level Classification E-value
Superfamily S13-like H2TH domain 6.48e-21
Family Middle domain of MutM-like DNA repair proteins 0.012
Further Details:      
 
Domain Number 2 Region: 63-131
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.000000144
Family N-terminal domain of MutM-like DNA repair proteins 0.012
Further Details:      
 
Domain Number 3 Region: 319-346
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000107
Family Ran binding protein zinc finger-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004853020.1.39548
Sequence length 606
Comment PREDICTED: endonuclease 8-like 3 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MVEGPGCTLNGEKIRALVHPGQAVTDVRGRALQSLERHSPPPAASVTEVSFQAAALKDSK
DSSRNFLRLFNGYVYSGVKTLGKELFMFFGPKALRIHFGMKGSILINPLAYKNKNGVSPV
FELQLTNDLICFFDSSVELRNSMESQQRIRMMEELDVCSPKFSFLRAESEVKKQKGRMLC
DVLLDQKVLPGVGNIIKNEALFDSGLHPAVKIFQLTDEQTHHLVKMIRDFSILFYRCCKT
GSAISKHYKVYKRPNCGQCHCKIIVCRLGENNRMTYFCSHCQKENPQHIDICKLPSRNTI
INWTSSRGNRLIDSVGRKSEEQWTCLVCTLVNKPSAETCDACLTSKPDSVLETQENSIVF
HNLVKYPCNSFGKAHTEVKINRKTVFGTTTLVLTDFTSKSSTLKRKESQIQTPDGEFQNS
LPTNVCFSDTRHPSKERTNYITQVSNKVNISPTVCSQSELFSSVHKKLKTTLYSMPDLKS
CKTGFSNSEPQLSVADSPCTLNAGSPRCSKHSRLCVVRVVRKDGENKGRRFYACPLPREA
QCGFFKWADLSFPFCNHGKRSIMRTVLKIGPNNGKNFFVCPFEKEKQCNFFQWAENGPGI
KIIPGC
Download sequence
Identical sequences G5C3P5
XP_004853020.1.39548 HGL_H00000264596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]