SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004856816.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004856816.1.39548
Domain Number 1 Region: 19-237
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.15e-77
Family Phosphate binding protein-like 0.00000323
Further Details:      
 
Domain Number 2 Region: 239-297,331-353
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 1.44e-19
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004856816.1.39548
Sequence length 361
Comment PREDICTED: porphobilinogen deaminase isoform X1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MSGNGVSAATAEEDGSKMRVIRVGTRKSQLARIQTDTVVAMLKALYPGLQFEIVAMSTTG
DKILDTALSKIGEKSLFTKELEYALERNEVDLVVHSLKDLPTVLPPGFTIGAICKRESPY
DAVVFHPKFVGKTLQTLPEKSVVGTSSLRRAAQLQRKFPHLEFKSIRGNLNTRLRKLDEQ
QEFSAIILAVAGLQRLGWQNRVGQILHPEECMYAVGQGALGVEVRAKDQDVLNLVDVLHD
PETLLRCIAERAFLRHLEGGCSVPVAVHTVMKDGQLYLTGGVWSLDGSDSMQETMQATIH
VPVQHEDGPEDDPQLVGITAQNIPRGAQLAAENLGISLANLLLSKGAKNILDVARQLNDV
H
Download sequence
Identical sequences G5BHN5
HGL_H00000278715 XP_004856816.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]