SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004863059.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004863059.1.39548
Domain Number 1 Region: 358-539
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 279-337
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000763
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0094
Further Details:      
 
Weak hits

Sequence:  XP_004863059.1.39548
Domain Number - Region: 28-104
Classification Level Classification E-value
Superfamily Tropomyosin 0.036
Family Tropomyosin 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004863059.1.39548
Sequence length 632
Comment PREDICTED: rac GTPase-activating protein 1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MDTMMLNLRSLFEQLVRRVEILSEGNELQFIQLAKDFEDFRKKWQRTDRELGKFKDLLMK
AETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEE
QKSALAFLNRGQPSSGNAGNKRLSTIDESGSILSDISFDKTDESLDWDSSFVKNLKLKKR
QKRRSSSQQFVDGPPGPVKKTRSIGSTVDQGNESIVAKTTVTVPSDGGPIEAVSTIETVP
YWTRSRRKTGTLQPWNSDSTLSSRPLEPRTETGTSSTPQSNGGMRLHDFVSKTVIKPESC
VPCGKRIKFGKLSLKCRDCRVVSHPECRERCPLPCIPTLTGTPVKIGEGMLADFVSQTSP
MIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICS
LLKDFLRNLKEPLLTFRLNKTFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHL
QRVAQSPSTKMDIPNLAKVFGPTIVAHAVPNPDPMTMLQDIKRQPKVVERLLLLPLEYWS
QFMIVEQENIEPLQVIENSNGFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRS
TLARNTPRFGSKTKSATNLGRQGNFFASPMLK
Download sequence
Identical sequences G5AU06
XP_004863057.1.39548 XP_004863058.1.39548 XP_004863059.1.39548 XP_012934539.1.39548 XP_012934540.1.39548 HGL_H00000309871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]