SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004865546.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004865546.1.39548
Domain Number 1 Region: 149-316
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.08e-29
Family Canonical RBD 0.0032
Further Details:      
 
Domain Number 2 Region: 73-147
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.37e-16
Family Canonical RBD 0.0000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004865546.1.39548
Sequence length 756
Comment PREDICTED: ribonucleoprotein PTB-binding 1 isoform X1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MPLRPSSLVPEGAGFPKMAADVSVTHRPQLSPEPGAEAEATETAERRTPEELPPLDPEEI
RKRLEHTERQFRNRRKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGE
QAEAAINAFHQSHLRDRELSVQLQPTDALLCVANLPPSLTQAQFEELVRPFGSLERCFLV
YSEHTGQSKGYGFAEYMKKDSAARAKSDLLGKPLGPRTLYVHWTDAGQLTPALLHSRCLC
VDRLPPGFSDVDTLRQALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAEAAQQRADG
LALGDSHLRVSFCAPGPPGRSMLAALIAAQATALNRGKGLLPEPNILQLLNNLGPSASLQ
LLLNPLLHSSVGGKQGLLGAPPAMPLLSGPALSTALLQLALQAQSHKKPGILGDSPLGPL
QAGPQPANPLLGDLSAGGTLAPELPPRRGKPPPLLPPLLGPSGGDREPMGLGPTAAQLTP
PPAPVGIRGPGLRGLQKDSGPLPTPTGVSLLGEPPKDYRIPLNPYLNLHSLLPATNLAGK
EARGWGCATRGRHQAEGALPNPPAPGGGSGTGGSGSKAFPLKSRLLSPLAGSRLPPEPGL
PDSYGFDYPSDVGPRRLFSHPREPALGPHGPSRHKMSPPPSGFSERSGGGGPLSHFYSGS
PTSYFTSGLQAGLKQSHLNKAVGSSPLGSSEGLLGLSPGPNGHSHLLKTPLGGQKRSFAH
LLPSPEPSPEGSYVGQHSQGLGGHYADSYLKRKRIF
Download sequence
Identical sequences G5B227
XP_004865546.1.39548 HGL_H00000293677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]