SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004868131.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004868131.1.39548
Domain Number 1 Region: 145-332
Classification Level Classification E-value
Superfamily E set domains 1.45e-52
Family Cytoplasmic domain of inward rectifier potassium channel 0.00026
Further Details:      
 
Domain Number 2 Region: 36-186
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.2e-24
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004868131.1.39548
Sequence length 360
Comment PREDICTED: inward rectifier potassium channel 13 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MDSSNCKVIAPLLSQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILIDMRWRWMMLVF
SASFVLHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI
GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDLAVVAH
IDGKPNLIFQVANTRPSPLTSVRVSAVLYQERESGELLQTSVDFHLDGISSEECPFFIFP
LTYHHSITPSSPLATLLQHENPPHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA
SLLTRGSKGEYQVKMENFDKTVPELPTPLVSKSPHRTDLDIRINGQSIDNFQISETGLTE
Download sequence
Identical sequences A0A0P6JEG4
HGL_H00000386251 XP_004868131.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]