SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004874278.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004874278.1.39548
Domain Number 1 Region: 7-99,205-270
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.72e-28
Family Canonical RBD 0.00000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004874278.1.39548
Sequence length 282
Comment PREDICTED: U1 small nuclear ribonucleoprotein A [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFK
EVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPS
AKKAVQGGAAAPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQM
PPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV
PGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK
Download sequence
Identical sequences G5C9W9
XP_004874278.1.39548 HGL_H00000243563-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]