SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004929038.1.14763 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004929038.1.14763
Domain Number 1 Region: 52-183
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 2.95e-33
Family Insect phospholipase A2 0.0000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004929038.1.14763
Sequence length 188
Comment PREDICTED: phospholipase A2-like [Bombyx mori]; AA=GCF_000151625.1; RF=representative genome; TAX=7091; STAX=7091; NAME=Bombyx mori; strain=p50T (= Dazao); AL=Scaffold; RT=Major
Sequence
MAACLYCFFLMIVLYINGVTGSWFANDAAVNIDEDVLDIQSETIARKKFDFIFPGTKWCG
KGDIAKNYEDLGSARETDMCCREHDHCTDLILAGETKHGLTNDAFYTRLNCKCDETFRLC
LNKANTKTSRRIGKIYFNALGTKCYRRDYPVVGCNTYGGLFRKKCLEYDYDTRSEQIYQW
FDVRNYAN
Download sequence
Identical sequences H9JTR7
XP_004929038.1.14763 Bmb023397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]