SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004959977.1.39314 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004959977.1.39314
Domain Number 1 Region: 100-288,330-438
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 8.11e-100
Family Transcriptional factor tubby, C-terminal domain 0.0000079
Further Details:      
 
Domain Number 2 Region: 43-95
Classification Level Classification E-value
Superfamily F-box domain 0.000000693
Family F-box domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004959977.1.39314
Sequence length 438
Comment PREDICTED: tubby-like F-box protein 7 [Setaria italica]; AA=GCF_000263155.2; RF=representative genome; TAX=4555; STAX=4555; NAME=Setaria italica; strain=Yugu1; AL=Chromosome; RT=Major
Sequence
MSFRSMVRDLRESFGNISRRNFEVRIHHRGKSLGSSSDLQDRPVVIQQSRWASLPPELLR
DVMKRLEEDESSWPSRKDVVSCASVCTTWRDMCKDIVRSPEICAKLTFPVSLKQPGPRDG
VIQCFIKRDKSKLTYRLYLCLSSAVLDENGKFLLAAKRSRRTTHTDYAISMDSKNFSRSS
TGYIGKLRSNFLGTKFIIYDTQPPYNAGRLCSQERAPSRRFSSRKVSPKVPIGSYPIAQV
NYELNVLGTRGPRRMQCTMQSIPESAVEPGGVVPGQPKELLPRLFDESFRSTATSLSKYS
IADSSMDLSSCRYSEFGGGNQQGDDNDADKERPLVLRNKAPRWHEQLQCWCLNFRGRVTV
ASVKNFQLIACVAQAAAARASAPPGQTQPQASSSHDTVILQFGKVARDMFTMDYRYPLSA
FQAFAICLTSFDTKLACE
Download sequence
Identical sequences K3Z6B7
Si022083m|PACid:19698967 Si022086m|PACid:19698968 XP_004959977.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]