SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004961432.1.39314 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004961432.1.39314
Domain Number 1 Region: 119-192
Classification Level Classification E-value
Superfamily F-box domain 8.11e-18
Family F-box domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004961432.1.39314
Sequence length 306
Comment PREDICTED: F-box protein At5g52880 isoform X1 [Setaria italica]; AA=GCF_000263155.2; RF=representative genome; TAX=4555; STAX=4555; NAME=Setaria italica; strain=Yugu1; AL=Chromosome; RT=Major
Sequence
MPVRRRQPRRQETGAAERYREMGIAAALSRPWDYPTACGELAALLRLGYVDLPKAAQALV
ASDVLLAFRLLPDVQTGYALSAANALLQAVEVALPKQKKAQAVSEFKHSVIAHKRRARVQ
QNSGLPHIPHDVLVHIFSFLDMHSLVAAGLVCWYWNSAANDNDLWKMNYSVFFGICHLSC
NSIPVSGVQNSRDLVQSSMDLVSIGPSFRWKESFHSKYTECASWKFASNRALCGHCRSVI
WLSNLTCTSPHHCPKNGRDEIKLQPLLPDTVAKYILHNDDLAASSSESDDTDDSDYENGH
PRFWTF
Download sequence
Identical sequences K3Z891
Si022761m|PACid:19701481 XP_004961432.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]