SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004975949.1.39314 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004975949.1.39314
Domain Number 1 Region: 132-323
Classification Level Classification E-value
Superfamily HCP-like 2.01e-38
Family HCP-like 0.0024
Further Details:      
 
Domain Number 2 Region: 49-95
Classification Level Classification E-value
Superfamily F-box domain 0.00000262
Family F-box domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004975949.1.39314
Sequence length 355
Comment PREDICTED: F-box protein At1g70590 [Setaria italica]; AA=GCF_000263155.2; RF=representative genome; TAX=4555; STAX=4555; NAME=Setaria italica; strain=Yugu1; AL=Chromosome; RT=Major
Sequence
MDDASQTWPPPAPSPPPFSSRPRASPSPHRRRRRRHYSKKHAPPPAPPTPPPTPAPQGAD
FSALPPELVHRALAAACASDVAAASRACRAWRDALRPLREAAALHAYGRRVKHGPVAGAA
ARGDGGRNEAERQRALGLFRRAARLGSAAAMVDAGLMCWEEGRRREAVEYYRSAAELGHP
VGMCNLGVSYLEADPHKAEEAIRWFYPSASAGNARAQYNLGLCLQNGKGIKRNQKEAAKW
YLRAAEGGNVRAMYNISLCYSYGEGLAQDLVRAKRWLQLAADCGHKKALYECGIKLCAAG
DKVKSLTYLELATRRGETAAAHMRDVILESLSAVNSQRALSDADKWKPRALHPRR
Download sequence
Identical sequences K3Y8B8
XP_004975949.1.39314 Si010459m|PACid:19695485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]