SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004979833.1.39314 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004979833.1.39314
Domain Number 1 Region: 362-606
Classification Level Classification E-value
Superfamily RNI-like 4.91e-42
Family Cyclin A/CDK2-associated p19, Skp2 0.032
Further Details:      
 
Domain Number 2 Region: 143-379
Classification Level Classification E-value
Superfamily RNI-like 3.14e-39
Family Cyclin A/CDK2-associated p19, Skp2 0.025
Further Details:      
 
Domain Number 3 Region: 10-48
Classification Level Classification E-value
Superfamily F-box domain 0.0000445
Family F-box domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004979833.1.39314
Sequence length 628
Comment PREDICTED: F-box/LRR-repeat protein 4 [Setaria italica]; AA=GCF_000263155.2; RF=representative genome; TAX=4555; STAX=4555; NAME=Setaria italica; strain=Yugu1; AL=Chromosome; RT=Major
Sequence
MRGADLINPALPDEILDDVIRRVGAGPGGGKRDLDACALVCRRWRRLERASRRSARLAAS
GEHADEVLRLVAERFPALADVSVDERLTSAGVVGAVPRSRRPRQAPTSSPFRRRRRLPLA
SNSVHIAPFPLDQPAGDDGSEHSCLTDVGLTHLSRGCRGLEKLSLIWCSAISSTGLVRIA
ENCKNLTSLDLQACYIGDPGLIAVGEGCKQLKNLNLRFVEGTTDEGLIGLVKGCGQSLVS
LAVATCVWLTDASLRAVGSHCPNLEILSVESDRVQDEGVISISKGCRQLKTLKLQCISAG
DEALDSIGLFCSLLESLSLNNFERFTDRSLSSIAKGCKNLTDLVLNDCQLLTDSSLEFVA
RSCKKLARLKVNGCQNMETAALEHIGRWCPGLLELSLIFCPRIQNSAFLEIGRGCSLLRT
LYLVDCSSISDSALCHIAQGCKNLTELSIRRGYEIGDQALISIAENCKSLKELTLQFCER
VSDTGMSAIAENCSLHKLNLCGCTLITDSGLTAIARGCPELVYLDISVLRIIGDIALAEI
GEGCPMLKEIAFSHCPEVTDVGLNHLVRGCLQLESCQMVYCRQITSAGVATIISGCSRLK
KLLVEESKVSERTRRRAGPVLSFLCTGL
Download sequence
Identical sequences K3ZHQ8
XP_004979833.1.39314 Si026110m|PACid:19708046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]