SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004986880.1.39314 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004986880.1.39314
Domain Number 1 Region: 10-54
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000709
Family F-box domain 0.0071
Further Details:      
 
Weak hits

Sequence:  XP_004986880.1.39314
Domain Number - Region: 102-144,183-244
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.051
Family Galactose oxidase, central domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004986880.1.39314
Sequence length 402
Comment PREDICTED: F-box protein At1g47340 [Setaria italica]; AA=GCF_000263155.2; RF=representative genome; TAX=4555; STAX=4555; NAME=Setaria italica; strain=Yugu1; AL=Chromosome; RT=Major
Sequence
MESGEGGGCRLPEELVVEILRRLPYRSLCRSRCVCRSWRDLSYHPDHRSRLPQDLAGLLY
TNHAPSHLHGDFAVRFAPAGSSPFPGLGFLPCGARALPLDCCNGLLLCRGGGGGGCHYVC
NPATGRFTTLPVPASGFQALALAAFEPHGASLRFHVLNFARAEPVQKVFFDADFEESEDD
TLSDTDGDAYGGGELCDLCEESSKFCVKGLEVFSSETGKWVQSRVCRESRVRLVEGMGSV
FISGYVNLLTHERKVLAVDPEGWACRLISLPVSSLFGLVGCLGHSQGFLQYAVQEDCTCT
MMQIWTLKDFEKGEWILKHRFEIEVAPQTKILFDYAGNALCSEIFYVVVFHPERDLVFLP
IEGYKMLSYNLINTEVKEICKLEPETRPRFLVYVPSYADFVN
Download sequence
Identical sequences K4AAS0
XP_004986880.1.39314 Si035977m|PACid:19682498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]