SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004994585.1.12839 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004994585.1.12839
Domain Number 1 Region: 572-777
Classification Level Classification E-value
Superfamily Bet v1-like 1.51e-30
Family STAR domain 0.0088
Further Details:      
 
Domain Number 2 Region: 286-396
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-21
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004994585.1.12839
Sequence length 791
Comment hypothetical protein PTSG_04492 [Salpingoeca rosetta]; AA=GCF_000188695.1; RF=representative genome; TAX=946362; STAX=946362; NAME=Salpingoeca rosetta; strain=ATCC 50818; AL=Scaffold; RT=Major
Sequence
MADFLRRTGSFVKRHTLGRYDQAAEEPQRKKGDRKDKAAPPLPEAPETEAEETHQHEQQQ
YQRRIEEEEQQQQQQQEEEEQEEEAAVDQDGDDTEVEEDLHHQRTPPLHEGAHSTAEAAH
TTNTTVNSSMRPAHASDLTAAHPDSDEQCGASRASVQDSAIDAIDADVAPNNPATATTDP
DTTIMPGAADGHAPPPVPSDADRTPSPHTCAGGRGSSRRRVRAASALSERTGTVVHLPAA
TTRATFMKHKRSISDVVSGSFMTDRHSPDALSDGTASDSGDEDVMPCREGVMAKWTNYIH
GWQDRYVVLQKGILSYFKSADDKQKFCRGTVDVVQARVKPHPYDQLRFDVILKDHAYYLR
ASSTEERGEWVKSLQETQRMRAKGLTRRPSSMSLTSISSGTSGHSYTRSVTDKYMESKAL
HDAFVGQIDQLQRALASLETADVGDLQRDAALVKSTSSGLLRAMTEWMDVMSRREEEWQR
KYERLSEKKRKLELEVRSSRDMAPQPFPNNPDLEEGPHSMLNDEEFFDALEIGLDQLEAE
EEEERRERELEAQRVANKPAPGSVMSHQFSSLLEGKLKENLKLADEPVEEMWLLTHEEGQ
MTVYTRNEEAAGETTDQLKAFHFIPGLTGREVCSYFFDTDLRLEWEHTVEKFFVLEWLDN
NTNVCHNIHKRVWPTAQRDSCILSHMRQLNTNRWMVQNTSVDHDDAPANKYVRLTANVLL
MAETQVPASADKSKLTRADIGAKLTYLAYVHPGGWAPASVVKAVSKREYPKFLSNLETHS
LKHFSSQPILW
Download sequence
Identical sequences F2U8Q4
PTSG_04492T0 XP_004994585.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]