SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005012469.1.99704 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005012469.1.99704
Domain Number 1 Region: 66-144
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.99e-36
Family Forkhead DNA-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005012469.1.99704
Sequence length 544
Comment PREDICTED: forkhead box protein J2 isoform X1 [Anas platyrhynchos]; AA=GCF_000355885.1; RF=representative genome; TAX=8839; STAX=8839; NAME=Anas platyrhynchos; breed=Pekin duck; AL=Scaffold; RT=Major
Sequence
MASDLESSLTSIDWLPQLTLRATIEKLGGSSQAGPPGAARKCPPGSPTDPNATLSKDEAA
VHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSL
NKCFRKVPRPRDDPGKGSYWTIDTCPDISRKRRHPPDDDIPQDSPEQEASKSPRGAVPVS
TEASLPSEATPQLSLQSTAPIANYSQQAAGPVDVASTVAGGQGREGADVPPPLYSANHDF
KFSYSEINFQDLSWSFRNLYKSMLEKSSSSQHGFSSLLGDMQPSNHNYYMYQQQQQQQGP
SAVGAAPPLHTPTPDGCPSQGGKQQGGESYVPPPVMSMHPPPMQHGGYHQHQQHHPHSHP
QQQPHQHQQQQQSQASINNAGFAFPDWCSNIDSLKESFKMVNRLNWSSIEHSQFSELMES
LRQAERKNWTLDQHHIANLCDSLNHFLTQTGQLPHLVGPQQPPRISDSCALNSGKQEQSM
NQVNSYGQPQPPHLFSGPSPMYQISTQDSPGYNRPAHHLVPRPPGPPPGANEEIPDDFDW
DLIT
Download sequence
Identical sequences U3J1G2
XP_005012469.1.99704 ENSAPLP00000013339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]