SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005018573.1.99704 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005018573.1.99704
Domain Number 1 Region: 5-128
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.88e-29
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 334-390
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000103
Family SAM (sterile alpha motif) domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005018573.1.99704
Sequence length 404
Comment PREDICTED: ankyrin repeat and SAM domain-containing protein 4B [Anas platyrhynchos]; AA=GCF_000355885.1; RF=representative genome; TAX=8839; STAX=8839; NAME=Anas platyrhynchos; breed=Pekin duck; AL=Scaffold; RT=Major
Sequence
MSSRYHKAAADGNLDLLKEATRKDLNTSDEDGMTPTLLAAYHGYLEALEVICRRGGDPDK
CDIWGSTPLHHAACNGHIHCVSFLINFGANIFALDNDLRTPLEVAASRDRHECVRILDKA
ATEQNLLNPKKVAKQKAQAQRNVEKQIKECEKRQEKHQHEMNRNYMKENAGTVTSSKGTH
SRVKIPSLFTSNTTTPFSKNLKDTFKLRTKKTAGSTRSQETQSNGQADEKDRRSVMHLFD
EKEEDELLNDNDSRLSIFQRPGLGKIVFGRNLAADVNPGIMSPEKEVISFKMSSELFQNE
SAENDREDDVENGADIPWQEEEGIWDDEEAENTPLEVFLASQMLDEFLPVFMREKIDLDT
LMLCSDEDLQSIQIELGPRKKVLNAVNKRKQALKNPGKTVDTCL
Download sequence
Identical sequences R0JXK4
XP_005018573.1.99704 ENSAPLP00000000377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]