SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005030555.1.99704 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005030555.1.99704
Domain Number 1 Region: 5-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.34e-46
Family Interferon regulatory factor 0.00000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005030555.1.99704
Sequence length 348
Comment PREDICTED: interferon regulatory factor 2 [Anas platyrhynchos]; AA=GCF_000355885.1; RF=representative genome; TAX=8839; STAX=8839; NAME=Anas platyrhynchos; breed=Pekin duck; AL=Scaffold; RT=Major
Sequence
MPVERMRMRPWLEEQINSNTIPGLKWINKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAI
HTGKYQSGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSK
KGKKTKSEKDDKFKQIKQEPVESSFGINGLNDVTSDYFLPSSIKNEVDSTVNIVVVGQPH
LDGSSEEQVIVANPPDVCQVVEVTTESDEQPLSMSQLYPLQISPVSSYAESETTDSVPSD
EENAEGRLHWQKKNIEGKQYLSNLGMRNTSHTLPSMATFVANKPDLQVTIKEESCPLPYN
SSWPPFPDIPLPQVVSTASTSSSRPDRETRASVIKKTSDITQSRVKSC
Download sequence
Identical sequences R0KKD4
XP_005030555.1.99704 XP_012964767.1.99704 ENSAPLP00000015303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]