SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005090685.1.21191 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005090685.1.21191
Domain Number 1 Region: 32-268
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-86
Family Calponin-homology domain, CH-domain 0.00000306
Further Details:      
 
Domain Number 2 Region: 287-408
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-33
Family Spectrin repeat 0.0001
Further Details:      
 
Domain Number 3 Region: 599-736
Classification Level Classification E-value
Superfamily Spectrin repeat 2.28e-31
Family Spectrin repeat 0.00023
Further Details:      
 
Domain Number 4 Region: 1007-1161
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-31
Family Spectrin repeat 0.0000456
Further Details:      
 
Domain Number 5 Region: 1226-1379
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-30
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 6 Region: 1544-1700
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-29
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 7 Region: 2281-2405
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-27
Family Pleckstrin-homology domain (PH domain) 0.00019
Further Details:      
 
Domain Number 8 Region: 1651-1805
Classification Level Classification E-value
Superfamily Spectrin repeat 9.24e-27
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 9 Region: 811-945
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-24
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 10 Region: 741-844
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-23
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 11 Region: 1863-2018
Classification Level Classification E-value
Superfamily Spectrin repeat 4.85e-23
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 12 Region: 418-517
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 13 Region: 522-633
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-22
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 14 Region: 1387-1487
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000157
Family Spectrin repeat 0.00095
Further Details:      
 
Domain Number 15 Region: 2022-2082
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000072
Family Spectrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005090685.1.21191
Sequence length 2436
Comment PREDICTED: spectrin beta chain-like isoform X3 [Aplysia californica]; AA=GCF_000002075.1; RF=representative genome; TAX=6500; STAX=6500; NAME=Aplysia californica; AL=Scaffold; RT=Major
Sequence
MTEIESLVNNVRWDPGVVDEDFDAVNNSSKLFERSRIKALADERELVQKKTFQKWVNSHL
IRVNHKIQDLYVDLRDGRMLIKLLEVLSGERLPRPTKGKMRIHCLENVDKALTFLHEQRV
HLENMGAHDIVDGSSRLTLGLIWTIILRFQIQDITIEEVDNNETKSAKDALLLWCQMKTA
GYPNVNVRNFTSSWRDGLAFNALIHKHRPDLIQYEKLQKSNAMHNLNNAFTTAEDKLGLT
SLLDPEDVNVEFPDEKSIITYVVTYYHYFSKMKADSVQGKRIGKVIDNAINTESMINQYE
SMTSDLLEWIEQTIVILNDRQFANSLTGVQQQLAAFSTYRIVEKPPKFDEKGNLEILLFT
IQSKMRANNQRPYLPKEGKLLSDINKAWERLDKAEHERELSLREELIRQEKLEQLAARFG
RKAGMREEWLSENQRLVAQDNFGNDLAAVEAATKKHEAIETDINAYEERVSAVVAVASEL
EQENYHDIDRINARRDNVLRLWNYLLELLQARRMRLELTLSLYKVFKEMLYILDWMEEIK
ARLLSEDYGKHLMGVEDLLQKHSLLEADVNVVGERVSTVNGQAQRFIDDDFSEIGGYRPC
NPEMIQERMNMLDSAYEELRQLAADRRRRLEESRKLWQFYWDMADEEGWIREKEQLMSSP
DLGHDLTSVNLLLSKHKAMEDEMTARHSHLQEVQTSSNELIEAGNFGADQIEQRNNEISS
QWESLIDLATYRKKRLNEAVDFYQFFADADDVDTWLMDTLRLVSSEDVGKDEASVQSLLK
KHKEVTEELKSYQSVIEALHEQAANLGEQDRESPDVQSRLTSIDRRYQELLEFSKLRKQR
LIDALSLYKLFNESDGVETWIDEKEKFLTTIIVTDDVEELAIMKHRFDSFEHEMNATASK
VAVVNQLARQLMQAEHPNAEEVVERQNQLNATWNNLREMVDHKRDDINVAHGFQNFNIEC
NETIGWIHEKAKLIESTDELGNDLSGVMTLQRRLSTMERDLAAIQAKLESLQGEAERLEE
QKPEEAEAIKEKIAEINNVWMDLKDMLKERDEKLGEAGELQRFLGSLDHFQSWLSRTQMT
VASEDIPNSLADAEKLLNQHQQLRDEIDTYAPEYAKIKEFGDKVTEGEEDPQYMFLRQRL
QALDDGWHELLQMWENRQQLLSQSLNLQMFLRDAKQAEVLLNQQDNFLSKEDVPIAPLDK
QTSVQAAENLIKRHEAFITTMDANDEKINAVLQFANRLMDENHYAGEKIQKKAESINERR
DQNRQRADEQLDRLKDQLTLQQFLQECDELRDWLQDKMAAAQDETYRDAKNLHSKYVRHQ
AFESEIAANKDRLNRVVEEGETIMSSKPETREQIEPMLSELSTQWEDLETTTKEKGERLF
DANRSTLYQQSCDDVDGWVTALESQIVTSEDFGKDLTTVNLQVQKQNHLENQMKMKEQQV
QELESQSEHLRRLEPDREEEIEARRALVAQRFAKIQGPLMMRRANLEKVKRIHQFMRDVE
DEKLWIEEMMPRATSTDYGNSLLSVQLLIKKNHSLQVEIDNHEPRIKSVVQVGQELIDAG
HSQSEEFRALIEDLLQRWQELKDAIDARNQRLKLSEIAQQYYFDAAEAEAWMSEQELYMM
GEERAKDEIGAQNMMKKHQTLENNVEDYAEVVRQLGERSRELMEEEHPESDQIAVRQSQV
DKFYAGLKDLAQERRGKLEEVFKLYTLHREIDDLLEWIADKSAVAGSNEPGQDYEHVSML
KERFKEFARDTENIGHERVASANEICDDLIASEHSDAASIAEWKDNVNDAWADLLELIDT
RTELLQTSWELHKFFYDCKDTLERIVEKQNYIPEELGRDAQSVAALQRKHANFEHDLVTL
GTQVEAIQTESLRLQAGYAGENAQTIVDREAEVLEAWKNLHVLVERRRLTLADASDYYRF
MLMARDLLLWIDDITRQMNTQEKPRDVSGVELLMNNHQSMKAEIDAREENFAICINLGRD
LLNRQHYKQEQVREKLIQLTLLRLDMTDLWNERWEHLQLILEVYQFARDAAVAEAWLIAQ
EPYLSNQDLGDTLDAVENLLKKHEAFEKSAATQEERFAALLKPTTFEIRDREKKKAEEYG
KSHPDEIEKQKEERRRQYIQEFLPPEPPKPEPVVEVEQPVAAAAPDNQVAPETVEEAVGQ
PISSEEKSETDAGVRRPRRERQSREAEEVDEPDSFHRRSHARNDYPQPSSESPSPRKPRG
GSGKKEKQLLEPERGETPQKRPRSRSPFAKLFRGKKDGEDGANDKPSPPLGREREEEVQR
LSKDEAAAPSESVSLEGMLSRKHELDVGERKAGNRSWDKLFLVLQGPSLSCYKDQKHAKT
DPNNRIHHEAAIDISGASCEVAADYTKRPFVFQLRLTNGGKYLFQAKDEGERDMWINRIN
QAAGPSAGAMPTKSQTLPARIEKEEPKKRGLFSRRK
Download sequence
Identical sequences XP_005090685.1.21191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]