SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005223393.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005223393.1.76553
Domain Number 1 Region: 546-576,714-788
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000135
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005223393.1.76553
Sequence length 960
Comment PREDICTED: testis anion transporter 1 isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MQPDRSFQSFASRYRQSSFTYDVKRDVYNEENFQQEHRKKTASSGNVDIDISTVSHHVQC
RCSWHKFRRCLLTVFPFLEWMCFYRFKDWLLGDLLAGISVGLVQIPQVLMLGLLARHLIP
PLNVSYAAFCASVIYGIFGSCHQMSIGTFFLVSALAINVLRTQPFNRGHLLLGTFIQADF
SNTSFYENYNRSLSSVASVTLLTGIIQLSMGMLGFGFIVAYIPEAAISAYLAATALHVML
SQLTCIFGIMISYNSGPIAFFYNIINYCLGLPKANSTSILLFLTAMVALRINKCIRISFN
QYPIEFPMEVFLVLGFAAFSNKVNMATENSLMLMEMIPYSFLFPVTPDMSNLTEVLIESF
SLALVSSSLLVFLGKKIASFHNYDVNSNQDLIAIGLCNVVSSFFRSYVFTGAVARTIIQD
KTGGRQQFASLVGAGIMLLLMMKMARFFYRLPNAIVAGIILSNVLPYLEAVYTLPSLWRQ
NQYDCLIWMVTFMSAILLGLDIGLVVAVTFAFFIITVQSHRTKILLLGQIPNTNIYRSFQ
DYREVANIPGVKIFQCCNAITFVNVHYLKRKVLEEIEMVKMPLTEEEIYTLFSQNEEGAQ
RGKICRCYCNCDEPEPSPRVIYTERYEVQRGRESSFINLVRCSRFESMNTAQTMSEDQVP
YITSSSSQRNPNYEEVEKVWLSDDPSRSMTITLPEASDTQVRATKLLPYSTSTILPSIHT
IILDFSMVHLVDARALVVLRQMFSAFQNANILVLIAGCHSFVVRSLEKNDFFDAGITKAQ
LFLTLHDAVLFALSRKLPESSELSVDESETVIQETFSETDKKEESRHKTNRSLIEAPRSK
SPGFSLLPDPEMEEESDLDLYSTIQMSKDHGLDLDLDLDREVEPESELEPESELDQETEL
EPEPEASPKPNRQKYWSLFRAIIPRSPTQTQARTQSVDRRHQNVKPYTSKADTSEDALEI
Download sequence
Identical sequences F1MEY3
ENSBTAP00000022931 ENSBTAP00000022931 XP_005223393.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]