SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005235089.1.75256 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005235089.1.75256
Domain Number 1 Region: 14-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-92
Family Calponin-homology domain, CH-domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 2192-2308
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-37
Family Pleckstrin-homology domain (PH domain) 0.00000295
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 603-742
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-32
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 5 Region: 1539-1695
Classification Level Classification E-value
Superfamily Spectrin repeat 7.52e-30
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 6 Region: 1011-1166
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-29
Family Spectrin repeat 0.0000235
Further Details:      
 
Domain Number 7 Region: 1223-1376
Classification Level Classification E-value
Superfamily Spectrin repeat 4.03e-28
Family Spectrin repeat 0.00049
Further Details:      
 
Domain Number 8 Region: 1858-2012
Classification Level Classification E-value
Superfamily Spectrin repeat 1.64e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 813-951
Classification Level Classification E-value
Superfamily Spectrin repeat 3.77e-25
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 10 Region: 425-528
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 11 Region: 1698-1803
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 529-637
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 13 Region: 746-847
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-21
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 14 Region: 1384-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-18
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 15 Region: 2017-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000389
Family Spectrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005235089.1.75256
Sequence length 2362
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1 isoform X1 [Falco peregrinus]; AA=GCF_000337955.1; RF=representative genome; TAX=8954; STAX=8954; NAME=Falco peregrinus; AL=Scaffold; RT=Major
Sequence
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVAKELETENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYI
MDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEG
YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQI
LSSDDYGKDLTSVVRLLSKHKAFEDEMSGRSGHFQQAIKEGEDMIAEEHFGSEKIRERIK
DIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQ
SLVKKHKDVAEEIASYRPTIDSLHEQAKALPQEHAGSLDVQGRLSGIEERYKEVAELTRL
RKQALQDTLALYKMFSEADACELWIDEKEKWLNNMQIPEKLEDLEVIQHRFESLEPEMNN
QASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNY
HLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAE
KLESEHPDQAQAILSRLAEINDVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSR
TQTAIASEDMPNTLTEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFL
RQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTT
LEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDKIQEKVDSIDDRHRKN
REAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFM
AELASNKEWLEKIEKEGMQLIAEKPETEAVVKEKLTGLHQMWEELESTTQTKAQRLFDAN
KAELFTQSCADLDKWLNGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEIEELQ
SQARALSQEGKSTDEVDGKRLTVEKKFLELLEPLNERKANLLASKEIHQFNRDVEDEILW
VGERMPIATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITESSPNAE
AIQQRLADLQQLWNLLIEETEKRHKRLEESHRAQQYYFDAAEAEAWMSEQELYMMSEEKA
KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRTLVADNHPESERISMRQSKVDKLYA
GLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFR
EFARDTGNIGQERVDTVNHMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQIL
AASYELHKFYHDAKEILGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVR
QLQEDAARLQAAYAGDKADDIQKRENEVLEAWKALLDACEGRRVRLVDTGDKFRFFSMVR
DLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARK
HYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLS
SREIGQSVDEVEKLIKRHEAFEKSAATWDERFAALERLTTLELLEVRRQQEEEERKRQPP
TPEPSPKVAEDADSQQQWDGTKGEQVSQNGLPSDQESPRVAETAETNEMVNGAAEQRTSS
KESSPVPSPTADRKAKTAIQAQTAATLPAKTQEIPSAQMEGFLHRKHEWETHSKKASSRS
WHNVYCVINNQEMGFYKDSKAAASGIPYHNEIPVSLKEAVCEIAVDYKKKKHVFKLRLTD
GNEYLFQAKDDEEMNTWIQAITSAISSDKIEVSPTTQSTPASSRAQTLPASVTITSESSP
GKREKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences XP_005235089.1.75256 XP_005445681.1.10750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]