SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005284992.1.60341 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005284992.1.60341
Domain Number 1 Region: 130-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000916
Family LDL receptor-like module 0.0042
Further Details:      
 
Domain Number 2 Region: 82-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000223
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005284992.1.60341
Sequence length 209
Comment PREDICTED: low-density lipoprotein receptor class A domain-containing protein 1 [Chrysemys picta bellii]; AA=GCF_000241765.3; RF=representative genome; TAX=8478; STAX=8479; NAME=Chrysemys picta bellii; AL=Chromosome; RT=Major
Sequence
MNRTHPQRSFGGISFDSTKSSSEERDRCQECSACLSCTRRCLCISIIALLALGVVGAVIG
FAVTFGLPPPTPVNRFCVTSGNQTGFLCDDRVTCLLASQICNRIRECVNGEDEQEKLCND
LPSNLPGYLIFRCSNPVYWIYADKKCNGANDCGDCSDEKGTLASCPPCGTQWWSCTPVFF
EYCTCIPRALCGDRIQHCSDWSDEYACNR
Download sequence
Identical sequences XP_005284992.1.60341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]