SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005419557.2.5688 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005419557.2.5688
Domain Number 1 Region: 11-271
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-56
Family YWTD domain 0.00000208
Further Details:      
 
Domain Number 2 Region: 623-878
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-55
Family YWTD domain 0.00000493
Further Details:      
 
Domain Number 3 Region: 322-552
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-50
Family YWTD domain 0.00000237
Further Details:      
 
Domain Number 4 Region: 925-1184
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-39
Family YWTD domain 0.0000599
Further Details:      
 
Domain Number 5 Region: 1315-1351
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1277-1313
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1236-1276
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 8 Region: 881-926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000371
Family EGF-type module 0.039
Further Details:      
 
Domain Number 9 Region: 579-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000464
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 276-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1193-1246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000644
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005419557.2.5688
Sequence length 1595
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Geospiza fortis]; AA=GCF_000277835.1; RF=representative genome; TAX=48883; STAX=48883; NAME=Geospiza fortis; AL=Scaffold; RT=Major
Sequence
MFPCFPSVASPFLLFANRRDVRLVDAGGTKLESTVVVSGLEDAAAVDFQYSQGIVFWTDV
SEEAIKQTYINQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANLNGTSR
KVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSMRKIIVDSDIYWPNGLTI
DLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHA
CNKQTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDPFYSCA
CPTGVQLEDDGRTCKAGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIAIDYDP
VEGYIYWTDDDVRAIRRAYLDGTGAQTLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEV
TRLNGTSRKILISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRVLVNTSL
GWPNGLALDLEKNKLYWGDAKTDKIEVINIDGTMRKTLLEDKLPHIFGFTLLGDYIYWTD
WQRRSIERVHKIKASRDIIIDQLPDLMGLKATSVTKAFGTNSCAENNGGCSHLCFFTPQE
ARCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDF
DVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRI
EVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSITLVDK
VGRANDLTIDYVDQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTD
WNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPN
GFRCGCAAHYTLDPNSRNCSSPASFLLFSQKSAISRMIPDDQQSPDIILPMHGLRNVKAI
DYDPLDKLIYWVDGRQNIIKRAKDDGTQPFTVMSTPNQSQNPEKQPHDLSIDIYSHTLYW
TCEATNSVNVHRLSGESIGMVLRGEHDRPRAIVVNAERGYMYFTNMQERAPKIERAALDG
TEREVLFTTGLIRPVALVVDNKLGKLFWVDADLKRIESCDLSGANRVTLEDSNILQPMGL
TVLGNHLYWIDRQQQMIERVEKVNGYKRTRIQGRIAHLTGIHAVEELDMEEFSVHPCSRD
NGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRC
DGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEADCDTICLPNQ
FRCASGQCILLKQQCDSFPDCIDGSDELMCEKLKPASDESQPHSSAIGPVIGIILSLFVM
GGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGKSMISS
MSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLYNAEMFYSSN
IPSNTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPPPPTPR
SQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_005419557.2.5688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]