SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005421095.2.5688 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005421095.2.5688
Domain Number 1 Region: 623-878
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 12-271
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-54
Family YWTD domain 0.0000015
Further Details:      
 
Domain Number 3 Region: 321-555
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-49
Family YWTD domain 0.00000317
Further Details:      
 
Domain Number 4 Region: 926-1185
Classification Level Classification E-value
Superfamily YWTD domain 1.15e-40
Family YWTD domain 0.0000407
Further Details:      
 
Domain Number 5 Region: 880-928
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1316-1354
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1278-1314
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 1238-1276
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 578-625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000229
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 10 Region: 274-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000402
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1195-1248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000226
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005421095.2.5688
Sequence length 1534
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Geospiza fortis]; AA=GCF_000277835.1; RF=representative genome; TAX=48883; STAX=48883; NAME=Geospiza fortis; AL=Scaffold; RT=Major
Sequence
MSVTNEHVEAAPLLLYANRRDLRLVDAAHGKENATVIVGGLEDAAAVDFVFLKGLIYWSD
VSEEAIKRTEFNRSGSVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLR
KVLFWQELDQPRAIALDPARGFMYWTDWGEAPKIERAGMDGSSRSIIVNTDIYWPNGLTL
DYEEQKLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILA
CSKYSGEDLREIHSNIFSPMDIHAFSQKRQPNATNPCGTNNGGCSHLCLMSPTKPSYQCA
CPTGVKLLENGKTCKDGATALLLLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDP
LEGYIYWTDDEVRAIRRSFLDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEV
TRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSL
GWPNGLALDYAEGKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLGDYIYWTD
WQRRSIERVHKGTAEREIIIDQLPDLMGLKATNVHQVIGTNPCAEDNGGCSHLCLYRPQG
LRCACPIGLELISDMRTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDF
DVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRI
EVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPN
VGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTD
WSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPV
GGFVCGCPAHYSLNSDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRA
IDYDPLDKQLYWIDSRQNIIRRAQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIY
WTCEATNVINVTRLDGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALD
GTEREVLFFSGLSKPIALAVDSQLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVG
LTVFENWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCSQ
DNGGCSHICIVKGDGSTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWR
CDGFTECEDHSDEKNCPVCSESQFQCESGQCIDSALRCNGEANCQDNSDEKNCEVLCLTD
QFRCASGQCIGKSKKCDHNLDCTDSSDEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGA
VYFICQRVLCPRMKGDGETMTNDYVVHGPPSVPLGYVPHPSSLSGKSRGMSRGKSVISSL
SIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSP
STHRSYSYRPYSYRHFVKPVFLSMILTYLLFCVV
Download sequence
Identical sequences XP_005421095.2.5688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]