SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005450984.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005450984.1.78416
Domain Number 1 Region: 31-265
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-78
Family Calponin-homology domain, CH-domain 0.000078
Further Details:      
 
Domain Number 2 Region: 1335-1449
Classification Level Classification E-value
Superfamily E set domains 3.06e-36
Family Filamin repeat (rod domain) 0.0000151
Further Details:      
 
Domain Number 3 Region: 1525-1643
Classification Level Classification E-value
Superfamily E set domains 4e-33
Family Filamin repeat (rod domain) 0.00000712
Further Details:      
 
Domain Number 4 Region: 469-576
Classification Level Classification E-value
Superfamily E set domains 2.94e-32
Family Filamin repeat (rod domain) 0.00086
Further Details:      
 
Domain Number 5 Region: 1067-1161
Classification Level Classification E-value
Superfamily E set domains 1.33e-31
Family Filamin repeat (rod domain) 0.00000972
Further Details:      
 
Domain Number 6 Region: 1448-1558
Classification Level Classification E-value
Superfamily E set domains 3.29e-31
Family Filamin repeat (rod domain) 0.0000236
Further Details:      
 
Domain Number 7 Region: 1827-1922
Classification Level Classification E-value
Superfamily E set domains 5.27e-30
Family Filamin repeat (rod domain) 0.0000077
Further Details:      
 
Domain Number 8 Region: 675-783
Classification Level Classification E-value
Superfamily E set domains 6.11e-29
Family Filamin repeat (rod domain) 0.0006
Further Details:      
 
Domain Number 9 Region: 1150-1257
Classification Level Classification E-value
Superfamily E set domains 1.27e-28
Family Filamin repeat (rod domain) 0.0000663
Further Details:      
 
Domain Number 10 Region: 1246-1356
Classification Level Classification E-value
Superfamily E set domains 4.47e-28
Family Filamin repeat (rod domain) 0.0000198
Further Details:      
 
Domain Number 11 Region: 760-873
Classification Level Classification E-value
Superfamily E set domains 9.34e-28
Family Filamin repeat (rod domain) 0.00071
Further Details:      
 
Domain Number 12 Region: 2013-2106
Classification Level Classification E-value
Superfamily E set domains 1.16e-27
Family Filamin repeat (rod domain) 0.0000287
Further Details:      
 
Domain Number 13 Region: 863-973
Classification Level Classification E-value
Superfamily E set domains 5.6e-27
Family Filamin repeat (rod domain) 0.00066
Further Details:      
 
Domain Number 14 Region: 2288-2378
Classification Level Classification E-value
Superfamily E set domains 8.01e-27
Family Filamin repeat (rod domain) 0.00000751
Further Details:      
 
Domain Number 15 Region: 381-479
Classification Level Classification E-value
Superfamily E set domains 2.25e-26
Family Filamin repeat (rod domain) 0.00095
Further Details:      
 
Domain Number 16 Region: 283-378
Classification Level Classification E-value
Superfamily E set domains 5.4e-25
Family Filamin repeat (rod domain) 0.00073
Further Details:      
 
Domain Number 17 Region: 2614-2704
Classification Level Classification E-value
Superfamily E set domains 8.01e-25
Family Filamin repeat (rod domain) 0.0000104
Further Details:      
 
Domain Number 18 Region: 578-670
Classification Level Classification E-value
Superfamily E set domains 1.07e-24
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 19 Region: 2479-2570
Classification Level Classification E-value
Superfamily E set domains 1.2e-24
Family Filamin repeat (rod domain) 0.00000827
Further Details:      
 
Domain Number 20 Region: 1632-1742
Classification Level Classification E-value
Superfamily E set domains 4.94e-23
Family Filamin repeat (rod domain) 0.0000615
Further Details:      
 
Domain Number 21 Region: 961-1064
Classification Level Classification E-value
Superfamily E set domains 5.94e-22
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 22 Region: 2386-2475
Classification Level Classification E-value
Superfamily E set domains 9.34e-22
Family Filamin repeat (rod domain) 0.0000144
Further Details:      
 
Domain Number 23 Region: 2221-2302
Classification Level Classification E-value
Superfamily E set domains 1.6e-21
Family Filamin repeat (rod domain) 0.00019
Further Details:      
 
Domain Number 24 Region: 1757-1842
Classification Level Classification E-value
Superfamily E set domains 1.73e-17
Family Filamin repeat (rod domain) 0.0000684
Further Details:      
 
Domain Number 25 Region: 1929-2009
Classification Level Classification E-value
Superfamily E set domains 1.6e-16
Family Filamin repeat (rod domain) 0.0000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005450984.1.78416
Sequence length 2705
Comment PREDICTED: filamin-C isoform X2 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MMSTNYGDDQLPPQYYQATDFGEEEDDEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKC
VNKTVTDLQKDFSDGLKLISLLEVLSQKKMYRKHHNRPNFRQMKLENVSVALEFLDREHI
KLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDDEDDEEAKKLTPKQRLLGWIQNK
VPQLPINNFNRDWRDGKALGALVDNCAPGLCPDWADWDPNKPVQNAREAMQQADDWLGVP
QVIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGAPLKPRQLFPNKAKAYGPGIEPHGNKV
LQPAVFTVETLEAGSGEVLVYVEDPEGHKEEAKVKPNNDKNRTYTVTYVPKVEGVHKVKV
LFAGQDIDKSPYTVNVAKALGDPSKVQARGPGLEPTGNVANKPTYFDIYTAGAGNGDVSV
VIVDPQGKKDTVELILENKGDSVFRCTYRPVLEGPHKIHVLFAGQEIPKSPFTVNIAEAI
NPNACRATGRGLQPTGVRVKEVADFKVFTKGAGSGALSVSVKGPTGAEEQVKVRDVGNGV
YECEYYPLKPGKYTVTITWGGQPIPRSPFEVQVGAEAGFQKVRAWGPGLKTGMVGKSADF
VVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDS
PFMAHILPAANDVFPEKVKAYGPGLKPTGVIVNKPAEFTVDARMAGKGQLKIYAQDAEGS
TIDIKITDRGDGTFHCVYTPVKPIKHTIIITWGEVNVPSSPFRVLVGEGSHPDRVKVYGP
GVEKTGLKANEPTYFTVDCSEAGQGDISIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVK
YTPPGPGRYTIMVLFADQEIPVSPFKVKVDPSHDAGKVRAEGPGLNKTGVEVGTPTHFNI
YTKGAGKAKPEVHFAASGPGEAIRDFEIIDNHDYSYTVKYTALQQGNMTISVTHGGDPIP
KSPFHITVSPAMDIGKVKVEGLDTKVEVGKDQEFTVNTKDAGGQGNVGVKMTSPSGRPIP
CKLESDKAKGAHSVKYIPPEEGQYKVDVSYDGNPVMGSPFGVEAVLPADPSKVRAFGPGL
KGGVVGKPAPFTIDTKGAGAGGLGLTVEGPCEAKIECQDNGDGTCSVAYLPTEPGEYAIN
ILFAEQHIPGSPFKAAVRPAFDPSKVTASGPGLERAKAGEPATFTVDCTRAGDGELTIEI
VSETGVKAEVHIQKTAEGTFSVTYIPPFHGTHTITIKYGGHVIPHFPKVLQVEPSVDTTG
VHVYGPGVEPRGVLREVTTHFIVDARALNKVGGNHVKVHIINPSGTNTDTYITDKGDGTY
RVEYTAFEDGMHLIEVLYDDVPVPKSPFRVSVVEGCDPTRVRAFGPGLEGGITNKPNCFT
VETRGAGTGGLGLTIEGASEAKISCKDNKDGSCSVEYVPFTPGDYDVNINYGGHPIPGSP
FRVPVKDPVDPSKVKCSGPGLGAGVRAHVPQTFTVDCTKAGQAPLDVKLYGPTGTVEPVG
VKNNGDGTHTVHYTPAQDGPYTVAVKYADQEVPHSPFKVMSQPGHDASKVRASGPGLDTK
GVPASLPVEFTIDARDAGEGLLTVQILDPEGKPKNATIQDNRDGTYTVSYVPDSTGPYTI
TIKYGGDEIPYSPYRIQSLPTGDASKCRVTVSIGGHGVSSLQKLQTSEDTVITVDAKAAG
KGKVTCKVLTPQGMEVDMDVVENHDGTFDIYYTAPEPGKYVITIRFGGQNIPKSPFHVMA
TNEPVVPRDTVDPLFRPVNFLVPFTPQQGEITGEVRMPSGKTARPHITDNKDGTITIKYQ
PTEKGLHEMDIKYDGNHIPGSPLQFFVDAVNSGVVTAYGPGLSYGMVNKAATFTVVTKNA
GEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYNIIVKFDNKHIPGSPFTAKIT
GDDSITRTSQLNVGTAADVSLKIAETDLSSLTASIRAPSGNEEPCLLKRLPNRHLGISFT
PKEVGEHEVSVRKNGMHVANSPFKIMVGQSEIGEASRVKAFGKGLVEAHTFEMAEFFVDT
RNAGYGGLALSIEGPSKVDINCEDVEDGTCRVTYCPTEPGSYTVNIKFAEKHIPGSPFTV
KVTGEGRIKESITRKRQASSIASVGSTCGLNLKIPGNWFQMVSAQERLTRTFTRSSHTYT
RTERTEISKIRGGETKREVRVEESTQVGGRGSPFRDVFGDFLGRESLSSFAGITARPEVE
SGSQAMTAQVTSPSGKTVDADIVDGGSSTYSVRFIPQEIGPHTVNVKYRGQHVPGSPFQF
TVGPMGEGGAHKVRAGGPGLERGVAGAPSEFSIWTREAGAGGLSIAVEGPSKAEISFEDR
KDGSCGVSYIVKEPGDYEVSIKFNNEHIPDSPFIVPIATLSDEARRLTVTSLQEKDLKVN
QEASFMVQRNGARGVVDAKVHTPSGSSEECYVTELDSDKSAIRFIPRENGVHSIDVKFNG
CHIPGSPFKVRVGDPGLIGDPGMVTAHGPGLQGGTTGVPSEFVVKTCNAGSGTLSVNIDG
PSKVKMDCRECPEGYKITYTPMAPGNYLITIKYGGPQHIVGSPFKAKITGTRLSGGHSLH
ETSSVLVETVTKTSKVGGAYSSSSSTTSSKMTSDASKVVCRGTGLSKALVGQKNNFTVDC
SKAGTNMLMVGVHGPHAPCEEVYVKHMGNKLYNVTYTVKDKGSYTVIVKWGDDNVPGSPY
KVAVP
Download sequence
Identical sequences I3JPF4
ENSONIP00000010748 ENSONIP00000010748 XP_005450984.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]