SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005454311.2.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005454311.2.78416
Domain Number 1 Region: 305-546
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-52
Family YWTD domain 0.00000184
Further Details:      
 
Domain Number 2 Region: 9-254
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-50
Family YWTD domain 0.00000337
Further Details:      
 
Domain Number 3 Region: 606-867
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-50
Family YWTD domain 0.00000531
Further Details:      
 
Domain Number 4 Region: 915-1170
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-37
Family YWTD domain 0.0000607
Further Details:      
 
Domain Number 5 Region: 1300-1337
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1223-1262
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000013
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 7 Region: 871-918
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000278
Family EGF-type module 0.026
Further Details:      
 
Domain Number 8 Region: 1263-1299
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000124
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 259-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000865
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 10 Region: 562-607
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000943
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1181-1233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000785
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005454311.2.78416
Sequence length 1603
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X1 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MQMGSEGESAIIVSDLEDAAAVDFLYSERLIFWTDVSEEAIKQTHWNQSSNSLKEALGTG
QTVVVSGLDSPDGLACDWLGKKLYWTDSETNRIEVANLDGTSRKVLFWMDLDQPRAIALN
PGQRYMYWTDWGEEPRIERAGMDGSNRKVIVNEDIYWPNGLTIDLVEQKLYWADAKLSFI
HRANLDGSARETVVEGTLTHPFALTLSEETLYWTDWQTRSIHACSKHSGDKTREILSGIY
SPMDIQVLEPYRQPDIQTPCSTDNGGCSHLCLLSPVEPFYSCACPTGVQLKPDRKTCKPG
AEQVLLLARRTDLRRISLDLPDFTDIVLQVDNIRHAIAIDYDPVEGYVYWTDDEVRAIRR
SSIDGSNATMLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILISENLE
EPRAIVLDPVNGYMYWTDWGEHPKIERANLDGTARLVLVNSSLGWPNGLAIDYTAGKLYW
GDAKTDKIEVISVDGSNRQTLLEDKLPHIFGFTLLGDHIYWTDWQRRSIERVHKTTAVRE
IIIDQLPDLMGLKATKVTETFGTNGCAGDNGGCSHLCFWRQQAVSCACPMGMELLSDLQT
CVVPEAFLLFTNRDNIRSISLGTNSNDVVIPVTGVKEASALDVYVYERRIYWTDIQAKTI
SRAYMNGSSVEHIIEFGLDYPEGMAVDWMGHNIYWADTGTNRIEVARLDGQYRQVLVCKD
LDNPRSLDNPRSLALDPANGYMYWTEWGGRPRIARAYMDGSTITTLVDKVGRANGLTIDY
VDHRLYWTDLDTCMIESTNMQGLQREIIVDDLPHPFGLTQYRDFIYWTDFNLRSIERADK
RSGYNRTVVLQGQLELMLDILVFHSSRQDGTNECTHNNGNCAHLCLATPAGAQCRCASHY
TLNPDGRNCSSPSSFLLFSQKASISRMVLGEQSPDIILPIHVMRNVRAVSYDPVERLVYW
LDGRQNIRRARDDGAMSSMIVSSTAQPVDNQLHDLSLDPYSRNIYWTCETTNTINVKRMD
GHTVGVVIKDDTDKPRAIVVNAEKGYMYFTTVQERSAKIEGASLDGTERESLFTTGLIRP
VALALDNKLGKLFWVDADLKRIESSDLTGANRIVLQDSNILQPMGLTVLGDHLYWIDRQQ
QMIERVDKLTGDGRTRIQGRISYLTSIHAVEEIDPQEFASHPCSRDNGGCSHICIAKGDG
TPRCSCPMHLVLLQDLLHCGEPPTCSTEQFTCSTGEIDCIPMAWRCDGFPECEDGSDEDN
CPICSAYQFRCDKGGCIDAQRRCNGELDCADHSDEQDCETICPPNQFRCGDNQCITKKQQ
CDNYSDCPDGSDELACEHVSPPSSGIPSTGPNTIGPVIAIILLVFIIGGAYFVCQRVVCR
RYKGPSGTFPHEYISGTPHVPLNFITPSGSQHGTYQGISCGKSMMSSVSLMGSSSSGAPL
YDRNHVTGASSSSSSSTKGAFYPQILNPPPSPATDRSLYNTEIFYSSNSPSTTRSYRPYN
PVRGTVPPTTPCSTDVCDSDYTPHHPPAGLGLSVGRWKGSGHGSHTKHKYYMDLNSDSDP
YPPPPTPRSQYMSAEESCPPSPSTERSYFHLCPPPPSPCTDSS
Download sequence
Identical sequences XP_005454311.2.78416 XP_019216752.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]