SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005462649.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005462649.1.78416
Domain Number 1 Region: 36-222
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.04e-41
Family G proteins 0.0000715
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005462649.1.78416
Sequence length 255
Comment PREDICTED: ras-like protein family member 11A [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MRLTGDPAPGTMNSSGSGNFLLVPIPEYPLLDCVPNKTVKIVVLGASNVGKTALIVRFLT
KRFIGDYEANTGALYSRKVTLEGEEVSLQIQDTPCVALQDDAEGLYCQEQINRSIYWADG
YVLVFSITDHNSYRTIQPLYQHVRRIHPSGNIPVILVGNKSDLLRARQVPADEGETLAAS
LGGVYFEVSARENHEGVHAAFLHLCQEVIRALGGGNGEKRRGGLHLARPKSPNMQELKRR
FRQVLSSKVKSATTI
Download sequence
Identical sequences I3K1E2
XP_004573460.1.88231 XP_005462649.1.78416 XP_005750981.1.53837 XP_014184558.1.24487 ENSONIP00000014937 ENSONIP00000014937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]