SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005475817.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005475817.1.78416
Domain Number 1 Region: 634-889
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-54
Family YWTD domain 0.00000418
Further Details:      
 
Domain Number 2 Region: 21-281
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-51
Family YWTD domain 0.00000192
Further Details:      
 
Domain Number 3 Region: 333-566
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-51
Family YWTD domain 0.00000351
Further Details:      
 
Domain Number 4 Region: 937-1198
Classification Level Classification E-value
Superfamily YWTD domain 9.81e-40
Family YWTD domain 0.0000471
Further Details:      
 
Domain Number 5 Region: 1330-1368
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1248-1288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 7 Region: 892-939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000486
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 1289-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000127
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 9 Region: 590-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000393
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 10 Region: 287-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000122
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 11 Region: 1206-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000907
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005475817.1.78416
Sequence length 1620
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X1 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MGVALRSLLLCSFCFLIRGEPLLLYANRRDLRLVDAAHEKANATVVVGGLEDAAAVDYVF
SKGLIYWSDVSEEAIKRTFFNQSGASTVETVVSGLASPDGLACDWLGSKLYWTDSETNRI
EVAELDGSLRKVLFWQELDQPRAIALDPERGFMYWTDWGEIPKIERAGMDGTNRSMIIDK
EIYWPNGLTLDYSQQKLYWADAKHSFIHRSNLDGSFREVVVKGELPHPFALTLFEDTLFW
TDWTTHSIHSCRKQTGGGQRVVHSSIFSPMDIHVFSTKRQPTAVNTPCSLNNGGCSHLCL
LSPVRPFYRCACPTGVQLLEDGKTCRDGATEMLLLARRTDLRRISLDMPDFTDIILQVDN
IRHAIAIDYDPVDGYVYWTDDDVKAIRRSLLDGSDAQFVVTSQVDHPDGIAVDWIARNLY
WTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGDVPKIERADLDG
MERVVMVNTSLGWPNGLALDYEERKIYWGDAKTDKIEVMNMDGTGRWVLVEDKLPHIFGF
TLLGDYIYWTDWQRRSIERVHKRTAVREFIIDQLPDLMGLKATNVHEAFGTNPCADDNGG
CSHLCLYKPQGVQCGCPIGLELIADMKTCIVPEAFLLFSRHTDIRRISLETNSNNVAIPL
TGVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKN
LYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDRAAM
DGTGRITLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGLDREVIADDLPHPFGL
TQYQDYIYWTDWSQRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQGGWNACASTNG
HCSHLCLAVPVSSFVCGCPAHFSLNYDNKTCSAPTSFLLFSQKTAINRMVIDEQQSPDII
LPIHNLRNVRAIDYDPLDKQLYWIDSKQNVIRRAQEDGNQSMTVVLGSLGGHSQGLQLYD
LSIDIYSRFIYWTSEVTNVINVTRIDGSRVGVVLRGEHDKPRAIVVNPERGYMYFTNLME
RSPKIERAALDGTEREVLFFSGLGKPVALAIDNEVGKLFWVDSDLRRIESSDLSGANRIV
IADSNILQPVGLTVFGNHLYWIDKQQQMIERIDKTTREGRTKIQARIAYLSDIHAVHELD
MREYSKHPCTWENGGCSHICIVKGDGTTRCSCPVHLVLLPDELSCGEPPTCSPEQFSCTS
GEVDCIPQAWRCDGYAECDDGSDEEDCPVCSDSEFQCDSRQCIELSLRCNGEINCQDKSD
ETKCEGEPVRCPADQFTCFNGQCIGKHKKCDHNMDCMDNSDETGCYPTEEPPPPPHNTIG
SIVAVVMALFVVGAIYFVCQRVLCPQMKDDGETVTNDFVVHGPSSVPLGYVPHPSSLSSS
LPGMSRGKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVR
SQYTVEFGYSSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRAPLKSSAAA
KGYTSDLNYDSEPFPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_005475817.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]