SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005475818.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005475818.1.78416
Domain Number 1 Region: 633-888
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-54
Family YWTD domain 0.00000418
Further Details:      
 
Domain Number 2 Region: 21-281
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-51
Family YWTD domain 0.00000192
Further Details:      
 
Domain Number 3 Region: 332-565
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-51
Family YWTD domain 0.00000351
Further Details:      
 
Domain Number 4 Region: 936-1197
Classification Level Classification E-value
Superfamily YWTD domain 9.81e-40
Family YWTD domain 0.0000471
Further Details:      
 
Domain Number 5 Region: 1329-1367
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1247-1287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 7 Region: 891-938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000486
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 1288-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000127
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 9 Region: 589-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000393
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 10 Region: 286-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000112
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 11 Region: 1205-1257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000907
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005475818.1.78416
Sequence length 1619
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X2 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MGVALRSLLLCSFCFLIRGEPLLLYANRRDLRLVDAAHEKANATVVVGGLEDAAAVDYVF
SKGLIYWSDVSEEAIKRTFFNQSGASTVETVVSGLASPDGLACDWLGSKLYWTDSETNRI
EVAELDGSLRKVLFWQELDQPRAIALDPERGFMYWTDWGEIPKIERAGMDGTNRSMIIDK
EIYWPNGLTLDYSQQKLYWADAKHSFIHRSNLDGSFREVVVKGELPHPFALTLFEDTLFW
TDWTTHSIHSCRKQTGGGQRVVHSSIFSPMDIHVFSTKRQPTVNTPCSLNNGGCSHLCLL
SPVRPFYRCACPTGVQLLEDGKTCRDGATEMLLLARRTDLRRISLDMPDFTDIILQVDNI
RHAIAIDYDPVDGYVYWTDDDVKAIRRSLLDGSDAQFVVTSQVDHPDGIAVDWIARNLYW
TDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGDVPKIERADLDGM
ERVVMVNTSLGWPNGLALDYEERKIYWGDAKTDKIEVMNMDGTGRWVLVEDKLPHIFGFT
LLGDYIYWTDWQRRSIERVHKRTAVREFIIDQLPDLMGLKATNVHEAFGTNPCADDNGGC
SHLCLYKPQGVQCGCPIGLELIADMKTCIVPEAFLLFSRHTDIRRISLETNSNNVAIPLT
GVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNL
YWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDRAAMD
GTGRITLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGLDREVIADDLPHPFGLT
QYQDYIYWTDWSQRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQGGWNACASTNGH
CSHLCLAVPVSSFVCGCPAHFSLNYDNKTCSAPTSFLLFSQKTAINRMVIDEQQSPDIIL
PIHNLRNVRAIDYDPLDKQLYWIDSKQNVIRRAQEDGNQSMTVVLGSLGGHSQGLQLYDL
SIDIYSRFIYWTSEVTNVINVTRIDGSRVGVVLRGEHDKPRAIVVNPERGYMYFTNLMER
SPKIERAALDGTEREVLFFSGLGKPVALAIDNEVGKLFWVDSDLRRIESSDLSGANRIVI
ADSNILQPVGLTVFGNHLYWIDKQQQMIERIDKTTREGRTKIQARIAYLSDIHAVHELDM
REYSKHPCTWENGGCSHICIVKGDGTTRCSCPVHLVLLPDELSCGEPPTCSPEQFSCTSG
EVDCIPQAWRCDGYAECDDGSDEEDCPVCSDSEFQCDSRQCIELSLRCNGEINCQDKSDE
TKCEGEPVRCPADQFTCFNGQCIGKHKKCDHNMDCMDNSDETGCYPTEEPPPPPHNTIGS
IVAVVMALFVVGAIYFVCQRVLCPQMKDDGETVTNDFVVHGPSSVPLGYVPHPSSLSSSL
PGMSRGKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVRS
QYTVEFGYSSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRAPLKSSAAAK
GYTSDLNYDSEPFPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_005475818.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]