SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005477555.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005477555.1.78416
Domain Number 1 Region: 6-377
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.16e-106
Family Motor proteins 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005477555.1.78416
Sequence length 826
Comment PREDICTED: kinesin-like protein KIF6 isoform X3 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MVKQTIQIFARIKPTKKNVAVYSVDNENQTGASLEFFVPKDLADGFVNNKRECYNFRFQK
VFDRVAKQEEIFENIAKPVADSVLAGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPR
TLSYLYERFSQDSSMVYTTHISYLEIYNEMGYDLLDSRHEASRLEDLPKVMIMEDQDQNI
HLRNLSLQQSASEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTVHLCRREPGSATMR
RSKLHLVDLAGSDRVSKTGLNGQLLTDAKYINLSLHYLEQVIIALSEKNRSHIPYRNSML
TSVLRDSLGGNCMTTMIATMAVERRNLEESISTCRFAQRVAVIKNEAILNEELDPALLIA
SLKREILSLKEELAMVTGEQRDDRLTPEEIQKLEELVKAYLDDPDSDVTLSLGPDMRKIQ
YCFSLLKVIIWDKKGGKKRCSDDKATPAATVREEEIQHSHQSAGEVAKLKEMLGQRDNEI
SILVKMLKKEKKRAQDAAAQLAHITNSQSQSTSSVSTVELSQEGSMETISADHRGRAIQY
MKRGPKLSMGKQEAFEIFIRDHEDHLTIEDNKSLLKQRSAEARELGEELNEARNRITELK
KQLDVRRRQRAAYGVMENHTGSEEEFDPVEENLCKHIEEEKKGYKSIVGRLKALRTEIEH
LQLLLERSKVKLQKDFHKWWSQEASSLQESESEAAAQSHTGTLNKTIQPSSPRALGFGAP
ALSSTVRDSPAGRHRNPDPSISSVQELRSFTPESKPPVPAVPAWQNKPVNRKVTDFTPSS
EWKTLTSATVSSSSIPLTGDQKTDADILAFIRARQNLVSRAGKHKQ
Download sequence
Identical sequences I3KU29
ENSONIP00000024625 ENSONIP00000024625 XP_005477555.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]