SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005509110.1.63277 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005509110.1.63277
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-55
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-49
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 3 Region: 783-1042
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-39
Family YWTD domain 0.0000538
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-28
Family YWTD domain 0.0000998
Further Details:      
 
Domain Number 5 Region: 1173-1208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1094-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 7 Region: 739-784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000331
Family EGF-type module 0.039
Further Details:      
 
Domain Number 8 Region: 1135-1170
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000191
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 134-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000318
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 11 Region: 1051-1104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005509110.1.63277
Sequence length 1453
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X1 [Columba livia]; AA=GCF_000337935.1; RF=representative genome; TAX=8932; STAX=8932; NAME=Columba livia; breed=Danish Tumbler; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDSSTRKIIVDSDIYWPNGLTIDLDEQKLYWADAKLSFIHRANL
DGSFRQKVVEGTLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILSALYSPMDI
QVLSPDRQPYFHTPCEESNGGCSHLCLLSPRDPFYSCACPTGVQLEDDGRTCKSGAEEVL
LLARRTDLRRISLDMPDFTDIILQIDNIRHAIAIDYDPVEGYIYWTDDDVRAIRRAYLDG
SGAQTLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAI
VLNPVMGYMYWTDWGESPKIECAYLDGSERRVLVNTSLGWPNGLALDLEKDKLYWGDAKT
DKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKIKASRDIIIDQ
LPDLMGLKATSVTKVFGTNSCAESNGGCSHLCFFTPQETRCACPIGLELLSDMKTCIIPE
AFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDNRIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGRNLYWADTGTNRIEVARLDGQHRQVLVWKDLDNPR
SLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSITLVDKVGRANDLTIDYADQRLYWTDLD
TSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGKNRTLIQG
HLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPNGFRCGCAAHYTLDPNSRNCSSP
ASFLLFSQKSAISRMIPDDQRSPDIILPMHGLRNVKAIDYDPLDKLIYWVDGRQNIIKRA
KDDGTQPFTVMSTPNQSQNPEKQPHDLSIDIYSHTLYWTCEATNSVNVHRLNGESIGMVL
RGDHDKPRAIVVNAERGYMYFTNMQDRAPKIERAALDGTEREVLFTTGLIRPVALVIDNK
LGKLFWVDADLKRIESCDLSGANRVTLEDSNILQPMGLTVLGNHLYWIDRQQQMIERVEK
INGYKRTRIQGRIAHLTGIHAVEELDMEEFSVHPCSHDNGGCSHICIAKGDGTPRCSCPE
HLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFPECDDQSDEDNCPICSASQ
YQCEKGQCIDVHLRCNGEIDCQDKSDEADCDTICLPNQFRCASGQCILLKQQCDSFPDCI
DGSDELMCEKTKPASDEAQPHSSAIGPVIGIILSLFVMGGMYFVCQRVVCQRYAGPNSHF
PHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGKSVISSMSLMGGSSGAPLYDRNHVTGAS
SSSSSSTKATFYPQILNPPPSPATDRSLYNAEMFYSSNIPSTTRSYRPYLIRGIAPPTTP
CSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPPPPTPRSQYMSAEESCPPSPATERSYFH
LYPPPPSPCTDSS
Download sequence
Identical sequences XP_005509110.1.63277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]