SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005570146.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005570146.1.63531
Domain Number 1 Region: 46-198
Classification Level Classification E-value
Superfamily C-type lectin-like 5.91e-35
Family C-type lectin domain 0.000000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005570146.1.63531
Sequence length 200
Comment PREDICTED: early activation antigen CD69 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MSSDHCYVTENSSLHPESGQENDATSPRFSTHREGSFQVPVLCAVMNVVFITILIIALIA
LSVGQYNCPGQYTFSMPSDSHVSSCSDDWVSYQRKCYFISTVKRSWTSAQSACSEHGATL
AVIDSVKDMNFLKRYAGGDEHWVGLKKEPGHPWKWSNGKEFNNWFNLTGSEKCAFLKNTE
VSSMECEKNLYWICNKPYKS
Download sequence
Identical sequences A0A2K6CQG8 F6QEG7 G7PJS2
ENSMMUP00000020060 XP_005570146.1.63531 XP_011771076.1.29376 XP_015006545.1.72884 9544.ENSMMUP00000020060 ENSMMUP00000020060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]