SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005572023.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005572023.1.63531
Domain Number 1 Region: 55-220
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-49
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005572023.1.63531
Sequence length 290
Comment PREDICTED: ankyrin repeat and sterile alpha motif domain-containing protein 1B isoform X21 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MQGDARRRRNENYFDDIPRSKLERQMAQSSVCEIWTNQNAGFPFSAIHQVHNTGDWGEPS
ITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMRA
NCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNISCAAQDPEDLSTFAYIT
KDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARKGGHSSTLPESFENKPS
KPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF
Download sequence
Identical sequences B7Z9I9
NP_001190994.1.87134 NP_001190994.1.92137 XP_003313926.1.37143 XP_004381323.1.4749 XP_004403928.1.74151 XP_005322447.1.77405 XP_005572023.1.63531 XP_005962140.1.78601 XP_006773403.1.95426 XP_006876008.1.41390 XP_007115888.1.24612 XP_007945388.1.48129 XP_009424346.1.37143 XP_010354249.1.97406 XP_011708722.1.29376 XP_011708723.1.29376 XP_011888167.1.92194 XP_011888168.1.92194 XP_012519483.1.63892 XP_012656682.1.62490 XP_013014652.1.53824 XP_014635710.1.5094 XP_014926332.1.86478 XP_015008004.1.72884 XP_015394580.1.5354 XP_017903632.1.57651 XP_018894400.1.27298 XP_019497260.1.44202 XP_020024747.1.5219 XP_020948674.1.46622 XP_020948675.1.46622 gi|323276657|ref|NP_001190994.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]