SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005586158.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_005586158.1.63531
Domain Number - Region: 120-188
Classification Level Classification E-value
Superfamily Kelch motif 0.0562
Family Kelch motif 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005586158.1.63531
Sequence length 228
Comment PREDICTED: claudin-10 isoform X1 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGV
SNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLA
GIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFC
FSISDNNKTPRYAYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV
Download sequence
Identical sequences A0A096MND5 A0A2J8X8Q4 A0A2K5KWC5 A0A2K5UHD7 A0A2K5YE18 A0A2K6D5S7 F6ZXB6 Q5R8E5
9544.ENSMMUP00000012721 ENSMMUP00000012721 XP_005586158.1.63531 XP_011732152.1.29376 XP_011852034.1.47321 XP_011890874.1.92194 XP_014976803.1.72884 ENSPANP00000001161 ENSMMUP00000012721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]