SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005611980.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005611980.1.31192
Domain Number 1 Region: 400-520
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.44e-18
Family Mannose 6-phosphate receptor domain 0.0066
Further Details:      
 
Domain Number 2 Region: 67-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000101
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 3 Region: 208-256
Classification Level Classification E-value
Superfamily EF-hand 0.0000602
Family Polcalcin 0.067
Further Details:      
 
Weak hits

Sequence:  XP_005611980.1.31192
Domain Number - Region: 28-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00017
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 124-220
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0141
Family FCH domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005611980.1.31192
Sequence length 535
Comment PREDICTED: glucosidase 2 subunit beta isoform X1 [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MLLLLLLLPVCWAVEVKRPRGVSLTYHHFYDETKPFTCLDGSATIPFDQVNDDYCDCKDG
SDEPGTAACPNGSFHCANAGYKPLYISSRWVNDGVCDCCDGTDEYNSGIVCENTCKEKGQ
KERETLQQMAEVTREGFRLKKILIEDWKKAREEKQKKLTELQDGKKSLEDQVEMLRTVKE
EAEKPEKEAKDQHRKLWEEQQAASRAQREQELAANAFQELDDDMDGTVSAAELQTHPELD
TDGDGALSEGEAQALLGGDAPTDSTAFYDRVWAAIRDKYRSEALSTEPPVPSAPDLPEPK
EEQPPVASPPSEDEEEEEEEEETEEEEEEEEEEETQGQGEQPKEPPPPLVPPQTASPGEE
DKMPPYDEQTQAFIDAAQEARNKFEEAERSLREMEESIRNLEQEISFDFGPDGEFAYLYS
QCYELATNEYIYRLCPFKMVSQKPKLGGSPTNLGTWGSWAGPEHDKFSAMKYEQGTGCWQ
GPNRSTTVRLLCGKETVVTSTTEPSRCEYLMELMTPAACPEPPPEVPAEGDHDEL
Download sequence
Identical sequences F6WTL6
ENSECAP00000021407 XP_005611980.1.31192 XP_005611981.1.31192 ENSECAP00000021407 9796.ENSECAP00000021407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]