SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005623262.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005623262.1.84170
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.99e-92
Family Calponin-homology domain, CH-domain 0.00000306
Further Details:      
 
Domain Number 2 Region: 2170-2289
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-33
Family Pleckstrin-homology domain (PH domain) 0.0000189
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-33
Family Spectrin repeat 0.0000942
Further Details:      
 
Domain Number 4 Region: 1640-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-29
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 584-741
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-29
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 6 Region: 1532-1687
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-28
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 7 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-27
Family Spectrin repeat 0.00000447
Further Details:      
 
Domain Number 8 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 2.54e-26
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 9 Region: 1229-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 6.55e-25
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 10 Region: 815-948
Classification Level Classification E-value
Superfamily Spectrin repeat 9.84e-25
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 11 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-22
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-19
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 13 Region: 1347-1447
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000419
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 14 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000273
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005623262.1.84170
Sequence length 2326
Comment PREDICTED: spectrin beta chain, erythrocytic isoform X1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSNLARVPCRITDLYKDLRDGRMLIKLLEVLSGEILPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIIVQTQEGRETRSAKDALL
LWCQMKTAGYPQVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTIVVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYQRELALRHELIRQEKL
EQLARRFDRKAAMRETWLNENQRLVVQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVKA
LEDLAQELEKENYHDQKRITARKDNILRLWNYLQELLRTRRQRLEMTLALQKLFQDMLHS
IDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATRQFAEEKGY
QPCDPQVIQDRVSHLEQCFEELSNMAAGRKAQVEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDTHLGQIFQEAEGMVARKQFGYPQIEVRIKE
VSAQWDQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRA
LGKKHKDFLEELEESRGVMEHLEQQAQGFPQEFRDSPDVTNRLQALQELYQQVVAQADLR
RQRLQDALDLYTVFGETDACELWMGEKEKWLAQMQIPDTLEDLEVAQHRFDILDQEMKTL
MTQIDGVNLAANSLVDSGHPRSGEVKQYQDHLNARWQAFQTIVSDRRGAVNSALRVRNYC
VDCEETSKWIEDKMQVVQSIKDLGQDLTGIISIQRKLSGLERDVAAIEARVGALERESQQ
LMASHPEQKEDIGQRQACVEKLWQELQEALKEQEASLGEASQLQAFLQHLDNFQTWLSMA
QKAVASEDMPESLPEAEQLLQQHVAIKDEIDGHRGDYQQVKASGENVIRDQTDPEYLLLG
QRLEGLDSGWDALCRMWESRNHSLAQCLGFQEFQRDAKQAEAILSNQEYTLAHVEPPDSL
EAAEAGIRKFEDFLVSMENNEDKVLSPVDSGNKLVADENLYSDKILEKVQLIEDRHRKNK
EKASEASIILKDNLELQNFLQNCQELTLWINDKLLTSQDVSYDDARNLQNKWAKHQAFMA
DLASHQGWLDSIDAEGKQLMEEKAQYAARVSQRLEDLHRLWDELQAATQERAQHLSAARS
SYLRSQTHADLSKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELFA
QVPSLGEEAGDADMSIEKRFLDLLEPLERRKKQLESSRAKLQISRDLEDETLWVEERLPL
AQSANYGTNLQTVQLLMKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDIEERLG
HLQGSWDTLREAAAGRLQRLRDASEAQQYYLDAGEAEAWISEQELYIISDEIPKDEEGAI
VMLKRHLRQQHTLEEYGRNIKQLAGRAQSLLSAGHPEGEQIIRLQGQVDKHYAGLRDVAE
ERRRKLENMYHLFQLKREADDLEQWIAEKELVASSPEMGQDFDHVTLLRDKFRDFARETG
AIGQERVDNVNLIIEQLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLH
RYFYTGTEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELQLLGLQVQQFQDVAT
RLQTAYAGEKAEAILNKEQEVTAAWQALLDACAGRRTQLVDTADKFRFFSMVRDLLSWME
NIIRQIETQEKPRDVSSVELLMKYHQGIKAEIDTRSKNFSACLELGESLLQRQHQASEEI
SEKLKQVLSRRKEMNEKWEARQEQLRMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHT
VDSVEKLIRRHEAFEKSTASWAERFAALEKPTTLELKERQTPERPEEESGPQEEEGETAG
EAPRGPHRTTTERTSPGEEERQWPQDLQPPLPPGPQEKSSGDERPATEPLFKVLDTPLSE
GDEPTTLPAQRDHGYSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELTFYKDAK
NLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEMLSWLQG
VSTAINESQSIRVKAQSLPLPSVAGPDASLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_005623261.1.84170 XP_005623262.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]