SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005651638.1.71052 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005651638.1.71052
Domain Number 1 Region: 520-627
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000746
Family Anti-sigma factor antagonist SpoIIaa 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005651638.1.71052
Sequence length 682
Comment sulfate permease [Coccomyxa subellipsoidea C-169]; AA=GCF_000258705.1; RF=representative genome; TAX=574566; STAX=248742; NAME=Coccomyxa subellipsoidea C-169; strain=C-169; AL=Contig; RT=Major
Sequence
MAGSTMTVEEEAGLIPLGYSPPNYYPPEGSASTRLFVKKEPSCTPLWTTIRKKCSLEGGL
PQIPCMRWMRNYNIRTCLMASADIIAGLTVGVMAVPQSVSFAAMAGLPAAYGLYTAFVPV
FAYSIIGSSRHLALGPVALVSLLLNDGLVKAIPGCDINENPNQPVDAHLQQIYNHAAIQV
SLMVAVLYLLLAVLRLGFLCSLLSRPIISAFLTAGALIISSSQVKYIVGYNIPHADRMQD
IVYNLIVRADRFRWMEFAMGLTWIALLVAIKSAPRFHKRVAWMGPLGPITVATLSVTAVW
AGQLEERFGIKVVGPIQAGMPPITVDWWLPMGDNWPRLVLTAGLIGAVSLLEAISIAKAL
AERNGDTVDADQELLGLGVCNLAGAVFCAYPSTGSFARAAGLVNAALIGFVLLCLTPVFQ
HMPLNALAAIVITGVIGLLDFQRALFLLQVSRMDCLVWLATFLGCLFISIDAGLGLGIAL
GLLFLFVRTAFPRIHVLRRLPGSTFFRDAGMYRLQESAEDGRTVVVSSQGPLCFANAQRI
KERLLEFAAGSQDGVACVVLDLASTTFIDATGIEVLTDLLLKAPAKLHVVLADPNTAALD
ILDRAGLLPKLGPERMFVRVHDAVAHCAALAVRSDDLGHPPVQNGQNGHSHAQYIVGSVP
GWREGSSDMNQPLLVHESIDNA
Download sequence
Identical sequences I0Z8X5
jgi|Coc_C169_1|45728|estExt_fgenesh1_pg.C_10045 XP_005651638.1.71052 jgi|Chlvu1|81305|estExt_fgeneshCV_pg.C_10566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]