SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005754850.1.53837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005754850.1.53837
Domain Number 1 Region: 633-888
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-54
Family YWTD domain 0.00000425
Further Details:      
 
Domain Number 2 Region: 332-565
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-51
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 3 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-51
Family YWTD domain 0.000002
Further Details:      
 
Domain Number 4 Region: 936-1197
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-39
Family YWTD domain 0.000038
Further Details:      
 
Domain Number 5 Region: 1326-1364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1247-1287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 7 Region: 891-938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000458
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 1288-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 9 Region: 589-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000377
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 10 Region: 286-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000105
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 11 Region: 1205-1257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005754850.1.53837
Sequence length 1546
Comment PREDICTED: low-density lipoprotein receptor-related protein 6-like [Pundamilia nyererei]; AA=GCF_000239375.1; RF=representative genome; TAX=303518; STAX=303518; NAME=Pundamilia nyererei; AL=Scaffold; RT=Major
Sequence
MGVALRSLLLCSFCFLIRGEPLLLYANRRDLRLVDAAHEKANATVVVGGLEDAAAVDYVF
SKGLIYWSDVSEEAIKRTFFNQSGASALETVVSGLASPDGLACDWLGSKLYWTDSETNRI
EVAELDGSLRKVLFWQELDQPRAIALDPERGFMYWTDWGEIPKIERAGMDGTNRSMIIDK
EIYWPNGLTLDYSQQKLYWADAKHSFIHRSNLDGSFREVVVKGELPHPFALTLFEDTLFW
TDWTTHSIHSCRKQTGGGQRVVHSNIFSPMDIHVFSTKRQSTVNTPCSLNNGGCSHLCLL
SPVRPFYRCACPTGVQLLEDGKTCRDGATEMLLLARRTDLRRISLDMPDFTDIILQVDNI
RHAIAIDYDPVEGYVYWTDDDVKAIRRSLLDGSDAQFVVTSQVDHPDGIAVDWIARNLYW
TDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGDVPKIERADLDGM
ERVVMVNTSLGWPNGLALDYEERKIYWGDAKTDKIEVMNMDGTGRRVLVEDKLPHIFGFT
LLGDYIYWTDWQRRSIERVHKRTAVREFIIDQLPDLMGLKATNVHEAFGTNPCADDNGGC
SHLCLYKPQGVQCGCPIGLELIADMKTCIVPEAFLLFSRHTDIRRISLETNSNNVAIPLT
GVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNL
YWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDRAAMD
GTGRITLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGLDREVIADDLPHPFGLT
QYQDYIYWTDWSQRSIERANKTSGQNRTVIQGHLDYVMDILVFHSSRQGGWNACASTNGH
CSHLCLAVPVSSFVCGCPAHFSLNYDNKTCSAPTSFLLFSQKTAINRMVIDEQQSPDIIL
PIHNLRNVRAIDYDPLDKQLYWIDSKQNVIRRAQEDGNQSMTVVSGSLGGHSQGLQLYDL
SIDIYSRFIYWTSEVTNVINVTRIDGSRVGVVLREEHDKPRAIVVNPERGYMYFTNLMER
SAKIERAALDGTEREVLFFSGLMKPVALAIDNEVGKLFWVDSDLRRIESSDLSGANRIVI
ADSNILQPVGLTVFGNHLYWIDKQQQMIERIDKTTREGRTKIQARIAYLSDIHAVHELDM
REYSKHPCTWENGGCSHICIVKGDGTTRCSCPVHLVLLPDELSCGEPPTCSPEQFSCTSG
EVDCIPQAWRCDGYAECDDGSDEEDCPVCSDSEFQCDSRQCIELSLRCNGEINCQDKSDE
NKCEVRCPADQFTCFNGQCIGKHKKCDHNMDCMDNSDETGCYPTEEPPPPSHNTIGSIVA
VVMALFVVGAIYFVCQRVLCPQMKDDGETVTNDFVVHGPSSVPLGYVPHPSSLSSSLPGM
SRGKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPTAKGYTSDLNYDSEPF
PPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_005754850.1.53837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]