SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005767338.1.92643 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005767338.1.92643
Domain Number 1 Region: 4-80
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000195
Family Calponin-homology domain, CH-domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005767338.1.92643
Sequence length 100
Comment hypothetical protein EMIHUDRAFT_197559 [Emiliania huxleyi CCMP1516]; AA=GCF_000372725.1; RF=representative genome; TAX=280463; STAX=2903; NAME=Emiliania huxleyi CCMP1516; strain=CCMP1516; AL=Scaffold; RT=Major
Sequence
MSAELLRGWLNDDVGLSRQVGSFEDDLANGYLIGELLHRHAVMTDSAFGGFKDQQAGAAI
AKIQNFRQVQQALVDLGVTFDSRLANAEGLFPGIHTMFLR
Download sequence
Identical sequences R1E1T8
jgi|Emihu1|197559|gm1.500738 XP_005767338.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]