SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005767813.1.92643 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005767813.1.92643
Domain Number 1 Region: 5-106
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000615
Family Calponin-homology domain, CH-domain 0.0084
Further Details:      
 
Weak hits

Sequence:  XP_005767813.1.92643
Domain Number - Region: 172-206
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0217
Family Trimerization domain of TRAF 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005767813.1.92643
Sequence length 207
Comment hypothetical protein EMIHUDRAFT_66448 [Emiliania huxleyi CCMP1516]; AA=GCF_000372725.1; RF=representative genome; TAX=280463; STAX=2903; NAME=Emiliania huxleyi CCMP1516; strain=CCMP1516; AL=Scaffold; RT=Major
Sequence
MDDDELQRIYTWVDEVPLSRPKRNIARDFADGVLTAEIVHHYFPRIVEVHNYPSANSYAQ
KMYNWQTLNARVFKKMGWQLRQEELDAICSCQPQAVERMLKQLQVRLSKYGSRSKEEEAA
PQRPHAQATPRSAAAPPRRVGGLAGGAQVGLRDGAVQELLAEKDQNISELRETVEILEIK
IQKLEQLVRLKDSKIATLQGKLQKYEP
Download sequence
Identical sequences R1C9R5
jgi|Emihu1|66448|e_gw1.48.26.1 jgi|Emihu1|78461|e_gw1.3869.1.1 XP_005767813.1.92643 XP_005771446.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]