SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005776169.1.92643 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005776169.1.92643
Domain Number 1 Region: 197-312
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.75e-17
Family Calponin-homology domain, CH-domain 0.00064
Further Details:      
 
Domain Number 2 Region: 48-76
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000285
Family LIM domain 0.024
Further Details:      
 
Weak hits

Sequence:  XP_005776169.1.92643
Domain Number - Region: 109-135
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000202
Family LIM domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005776169.1.92643
Sequence length 333
Comment hypothetical protein EMIHUDRAFT_373872, partial [Emiliania huxleyi CCMP1516]; AA=GCF_000372725.1; RF=representative genome; TAX=280463; STAX=2903; NAME=Emiliania huxleyi CCMP1516; strain=CCMP1516; AL=Scaffold; RT=Major
Sequence
MSKFCSSCGEPARLCHCKGRPSLPNCTSGSGQAPVGPSPGRASDQRTGLPACKGCGKPVQ
CRTISAMGGAYHPECFKCAGCGGAFVDRAAGFVEHGGCAYHRGCFTAPARACHFCSQPLI
GQAMKAAGAEFHPQCLPRCGTCGVSLEAGWYHDPSTDVRYCAAHAPRAPARGGRRAGSGT
VSAAALRLPRPPAVEQLDMRHMLKWAETAAAQSDPTVHIIDWSRSFADGRAFLAILRTYF
PEAVDASVLASSACAGEGSRLRAPEVRSACAHAFRLADELAGVPQLLDEGDMARNYPLPD
EKSVITYVCTLWGGLARAAERTEGKAGGVSASA
Download sequence
Identical sequences R1EAK2
XP_005776169.1.92643 jgi|Emihu1|373872|fgenesh_newKGs_kg.2831__1__2693091:1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]